Align UDP-glucose 4-epimerase (EC 5.1.3.7; EC 5.1.3.2) (characterized)
to candidate WP_028488019.1 Q394_RS0103275 UDP-glucose 4-epimerase GalE
Query= metacyc::BSU38860-MONOMER (339 letters) >NCBI__GCF_000621325.1:WP_028488019.1 Length = 343 Score = 446 bits (1147), Expect = e-130 Identities = 218/336 (64%), Positives = 264/336 (78%), Gaps = 3/336 (0%) Query: 3 ILVTGGAGYIGSHTCVELLNSGYEIVVLDNLSNSSAEALNRVKEITGK-DLTFYEADLLD 61 ILVTGGAGYIGSHTCVELL +G+++VVLDNL NSS E+L RV EI+G+ + FYE D+ D Sbjct: 7 ILVTGGAGYIGSHTCVELLAAGFQVVVLDNLCNSSPESLRRVAEISGQASIPFYEGDIRD 66 Query: 62 REAVDSVFAENEIEAVIHFAGLKAVGESVAIPLKYYHNNLTGTFILCEAMEKYGVKKIVF 121 +D +F E I +VIHFAGLKAVGESV PL+YY NN+ GT L +AM+++GV+ IVF Sbjct: 67 PVLLDRIFKEQAIYSVIHFAGLKAVGESVEKPLEYYDNNVAGTVSLLQAMQRHGVRNIVF 126 Query: 122 SSSATVYGVPETSPITEDFPLGATNPYGQTKLMLEQILRDLHTADNEWSVALLRYFNPFG 181 SSSATVYG P T+PI E FPL ATNPYG++KLM+E++L DL+ AD W +ALLRYFNP G Sbjct: 127 SSSATVYGDPHTTPIQEHFPLSATNPYGRSKLMIEEMLGDLYKADPAWKIALLRYFNPVG 186 Query: 182 AHPSGRIGEDPNGIPNNLMPYVAQVAVGKLEQLSVFGNDYPTKDGTGVRDYIHVVDLAEG 241 AH SG+IGEDP G+PNNLMPY+A+VAVG+ E LSVFG DYPT+DGTGVRDYIHVVDLA+G Sbjct: 187 AHESGKIGEDPQGVPNNLMPYIARVAVGQYEYLSVFGGDYPTQDGTGVRDYIHVVDLAKG 246 Query: 242 HVKALEKVLNSTGAD--AYNLGTGTGYSVLEMVKAFEKVSGKEVPYRFADRRPGDIATCF 299 HVKALE L + NLGTG GYSVL+MVKAF + SG+EVPYR RR GDIA C+ Sbjct: 247 HVKALEAFLRGDVPNLLLINLGTGQGYSVLDMVKAFAEASGREVPYRIVARRAGDIACCY 306 Query: 300 ADPAKAKRELGWEAKRGLEEMCADSWRWQSSNVNGY 335 ADPA A++ + W+A++ L EMC D+W WQ N GY Sbjct: 307 ADPALAEQLIHWKAEKNLVEMCQDTWHWQKHNPQGY 342 Lambda K H 0.315 0.134 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 464 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 339 Length of database: 343 Length adjustment: 29 Effective length of query: 310 Effective length of database: 314 Effective search space: 97340 Effective search space used: 97340 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate WP_028488019.1 Q394_RS0103275 (UDP-glucose 4-epimerase GalE)
to HMM TIGR01179 (galE: UDP-glucose 4-epimerase GalE (EC 5.1.3.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01179.hmm # target sequence database: /tmp/gapView.26318.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01179 [M=332] Accession: TIGR01179 Description: galE: UDP-glucose 4-epimerase GalE Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-142 459.7 0.0 2.6e-142 459.5 0.0 1.0 1 lcl|NCBI__GCF_000621325.1:WP_028488019.1 Q394_RS0103275 UDP-glucose 4-epi Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000621325.1:WP_028488019.1 Q394_RS0103275 UDP-glucose 4-epimerase GalE # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 459.5 0.0 2.6e-142 2.6e-142 1 331 [. 6 341 .. 6 342 .. 0.98 Alignments for each domain: == domain 1 score: 459.5 bits; conditional E-value: 2.6e-142 TIGR01179 1 kiLvtGgaGyiGshvvrqllekgkevvvlDnlskgskealkalekit...evklvegdladkekleavl 66 kiLvtGgaGyiGsh++++ll++g++vvvlDnl+++s e+l+++ +i+ ++ ++egd++d l++++ lcl|NCBI__GCF_000621325.1:WP_028488019.1 6 KILVTGGAGYIGSHTCVELLAAGFQVVVLDNLCNSSPESLRRVAEISgqaSIPFYEGDIRDPVLLDRIF 74 79*******************************************9998899***************** PP TIGR01179 67 eeekidaviHfaaliavgEsvkePlkYYennvvntleLleamqkagvkkliFsssaavYgesekvpisE 135 +e++i +viHfa+l+avgEsv++Pl+YY+nnv +t++Ll+amq++gv++++Fsssa+vYg+++++pi+E lcl|NCBI__GCF_000621325.1:WP_028488019.1 75 KEQAIYSVIHFAGLKAVGESVEKPLEYYDNNVAGTVSLLQAMQRHGVRNIVFSSSATVYGDPHTTPIQE 143 ********************************************************************* PP TIGR01179 136 esplnpinpYGrsklmvErilkdlkkadkelkvviLRYFnvaGAdeegeiGeasknat.hliklvaeva 203 ++pl+++npYGrsklm+E++l dl kad+++k+++LRYFn++GA+e+g+iGe++++ + +l++++a+va lcl|NCBI__GCF_000621325.1:WP_028488019.1 144 HFPLSATNPYGRSKLMIEEMLGDLYKADPAWKIALLRYFNPVGAHESGKIGEDPQGVPnNLMPYIARVA 212 **********************************************************9********** PP TIGR01179 204 vgkrekleifGtdyptkDGtcvRDyiHveDlaeaHlaalealeeg..gesevynlGagqgfsvkeviea 270 vg+ e l++fG+dypt+DGt+vRDyiHv Dla++H++alea +g + + nlG+gqg+sv+++++a lcl|NCBI__GCF_000621325.1:WP_028488019.1 213 VGQYEYLSVFGGDYPTQDGTGVRDYIHVVDLAKGHVKALEAFLRGdvPNLLLINLGTGQGYSVLDMVKA 281 ******************************************99833456678**************** PP TIGR01179 271 vkkvsgkdikveladrRaGDpaslvadaskikrelgwkpkyddLeeiiksawdWekklkeg 331 + ++sg+++++++ +rRaGD+a+++ad++ +++ + wk++ + L e+++++w+W+k++++g lcl|NCBI__GCF_000621325.1:WP_028488019.1 282 FAEASGREVPYRIVARRAGDIACCYADPALAEQLIHWKAEKN-LVEMCQDTWHWQKHNPQG 341 ****************************************99.***************987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (332 nodes) Target sequences: 1 (343 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 9.04 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory