Align High-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG (characterized, see rationale)
to candidate WP_028488592.1 Q394_RS0106655 urea ABC transporter ATP-binding protein UrtD
Query= uniprot:A0A159ZWS6 (255 letters) >NCBI__GCF_000621325.1:WP_028488592.1 Length = 263 Score = 144 bits (363), Expect = 2e-39 Identities = 85/252 (33%), Positives = 147/252 (58%), Gaps = 12/252 (4%) Query: 5 ILKVENLSMRFGGLLAVNGVALTVKEKQVVALIGPNGAGKTTVFNCLTGFYQPTGGTILL 64 IL +E+L++ F G A+N + L + + ++ +IGPNGAGKTT+ + +TG +P G Sbjct: 22 ILYLEDLNVSFDGFKAINNLTLYIDKGELRCIIGPNGAGKTTMMDIITGKTRPDSGQAWF 81 Query: 65 DGEPIQ--GLPGHHIARKGVVRTFQNVRLFKDMTAVENLLIAQHRHLNTNFFAGLFKTPA 122 G+ + L IA G+ R FQ +F+ + ENL +A H + + + A Sbjct: 82 -GQTVDLLKLSEPEIANAGIGRKFQKPTVFESHSVAENLELAMHGNKSV-----WYSLRA 135 Query: 123 FRKSEREAMEYAEYWLDKVNLTEFANRPAGTLAYGQQRRLEIARCMMTRPRILMLDEPAA 182 E++A+ + L + LT+ ++ AG L++GQ++ LEI ++ +P +L++DEP A Sbjct: 136 RLSGEQQAL--IDETLQTIGLTDHYHQAAGALSHGQKQWLEIGMLLVQKPYLLLVDEPVA 193 Query: 183 GLNPKETEDLKALIGVLREEHNVTVLLIEHDMKLVMSISDHIVVINQGTPLADGTPEQIR 242 G+ +E E L+ L +H+V V +EHDM V SI+ + V++QG+ LA+GT ++++ Sbjct: 194 GMTHQEMERTAELLTSLAGKHSVVV--VEHDMDFVRSIAHQVTVLHQGSVLAEGTMDEVQ 251 Query: 243 DNPEVIKAYLGE 254 ++ VI+ YLGE Sbjct: 252 NDQRVIEVYLGE 263 Lambda K H 0.321 0.138 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 156 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 263 Length adjustment: 24 Effective length of query: 231 Effective length of database: 239 Effective search space: 55209 Effective search space used: 55209 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory