Align D-2-hydroxyglutarate dehydrogenase (EC 1.1.99.39) (characterized)
to candidate WP_028583174.1 G494_RS0101925 FAD-binding protein
Query= BRENDA::Q8N465 (521 letters) >NCBI__GCF_000429965.1:WP_028583174.1 Length = 471 Score = 208 bits (530), Expect = 3e-58 Identities = 143/475 (30%), Positives = 230/475 (48%), Gaps = 32/475 (6%) Query: 59 FSTVSKQDLAAFERIV-PGGVVTDPEALQAPNVDWLRTLRGCSKVLLRP------RTSEE 111 +S +S + A + + PG VVTDP L+ + SK+ P ++ + Sbjct: 5 YSPISSRIRAEIQAALSPGAVVTDPAELR-------KYCNDASKLCFSPEMVVCAQSVAD 57 Query: 112 VSHILRHCHERNLAVNPQGGNTGMVGGSVPVFDEIILSTARMNRVLSFHSVSGILVCQAG 171 V +++ V P+G +G+ GG + ++LST R+ + V+GIL Q+G Sbjct: 58 VQAVMKLAQRHRFPVTPRGSGSGLAGGCLADQGGLVLSTERLREITLIDPVNGILKAQSG 117 Query: 172 CVLEELSRYVEERDFIMPLDLGAKGSCHIGGNVATNAGGLRFLRYGSLHGTVLGLEVVLA 231 + +E+ P D IGGN AT+AGG ++YG+ +LGLE VLA Sbjct: 118 AISQEVKDAAASVGLYYPPDPAGMDLSTIGGNAATDAGGPACVKYGTTRDYILGLEAVLA 177 Query: 232 DGTVLDCLTSLRKDNTGYDLKQLFIGSEGTLGIITTVSILCPPKPRAVNVAFLGCPGFAE 291 DG +L+ RK GYDL L IGSEGTLGIIT++ + P+P A+ Sbjct: 178 DGQLLETGVQTRKGVVGYDLTNLLIGSEGTLGIITSLWLRLIPRPPAITGMMAVFSDMQS 237 Query: 292 VLQTFSTCKGMLGEILSAFEFMDAVCMQLVGRHLHLASPVQESPFYVLIETSGSNA--GH 349 +++ + G + A EF+D C+ LVG L P +P +++E G A Sbjct: 238 AMRSVTRIMAG-GHLPCAIEFLDHRCLSLVGEMLPFGLP-GTTPSLLILELDGPGAQIAE 295 Query: 350 DAEKLGHFLEHALGSGLVTDGTMATDQRKVKMLWALRERITEALSRDGYVY-KYDLSLPV 408 + E++ +E G+V A +Q + + +WA+R +++ + +Y D+++P+ Sbjct: 296 EKERINELME---AEGVVALVNAANEQER-EEIWAIRRQVSLRIHDYANLYDPEDVAVPL 351 Query: 409 ERLYDIVTDLRARLGPHAKHVVGYGHLGDGNLHLNVTAEAFS-----PSLLAALEPHVYE 463 + +V L A + + +GH GDGN+HL+VTA+ + + AL H E Sbjct: 352 STIATLVDQLSAYEAEYGVEIFAFGHAGDGNIHLSVTAQDGDRRNQVTAAVKALLAHSLE 411 Query: 464 WTAGQQGSVSAEHGVGFRKRDVLGYSKPPGALQLMQQLKALLDPKGILNPYKTLP 518 G++S EHG+G KR L P ++ L +++KAL DP ILNP K P Sbjct: 412 ----LGGTISGEHGIGLAKRQYLPMEIAPASVALQEEIKALFDPNKILNPGKVFP 462 Lambda K H 0.321 0.139 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 629 Number of extensions: 29 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 521 Length of database: 471 Length adjustment: 34 Effective length of query: 487 Effective length of database: 437 Effective search space: 212819 Effective search space used: 212819 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory