Align TRAP transporter, subunit DctM (characterized, see rationale)
to candidate WP_028583498.1 G494_RS0103990 TRAP transporter large permease
Query= uniprot:I7DRS6 (467 letters) >NCBI__GCF_000429965.1:WP_028583498.1 Length = 446 Score = 253 bits (647), Expect = 7e-72 Identities = 154/473 (32%), Positives = 248/473 (52%), Gaps = 56/473 (11%) Query: 3 VVLLFSMVIGLLLIGVPIAVALGLSSTLFLLIYSDSSLASVAGTLFEAFEGHFTLLAIPF 62 V +LF +GLLLIG PI V+LG+S+ + +Y D + + F + G F L+A+P Sbjct: 6 VWVLFGSFLGLLLIGAPITVSLGVSA-MAAFMYLDENPIKLVQIAFRSV-GSFPLMALPS 63 Query: 63 FILASSFMTTGGVARRIIRFSIACVGHLPGGLAIAGVFACMLFAALSGSSPATVVAIGSI 122 FILA + M GV+RR++ + + G + GGL A V AC+ F A+SGS PAT A+G + Sbjct: 64 FILAGALMEAAGVSRRLVNVAESFAGPITGGLGAATVLACIFFGAISGSGPATTAAVGML 123 Query: 123 VIAGMRQVGYSKEFAAGVICNAGTLGILIPPSIVMVVY----------AAAV-------E 165 +I M GY + +A+ + ++G LG+++PPSI MV++ A AV Sbjct: 124 MIPAMVNRGYDRGYASAITASSGGLGVIVPPSIPMVIFGISGMGMQAPAEAVARFGEFQS 183 Query: 166 VSVGRMFLAGVIPGLMAGLMLMVTIYVMAKVKNLPKGEWLGW--GEVAASAANASVGLLL 223 +S+ ++F+AG +P L+ +++ Y ++ + G W GE+ + + +L Sbjct: 184 LSIPKLFIAGFLPALLIATGVLIANYFRSRKRGYT-GISDNWSVGEMIKTIKSGIWSILA 242 Query: 224 IGIILGGIYGGIFTPTEAAAVASVYAFFVATFVYRDMGPLKSAPKPKDMGQFLTMLPKML 283 IILGGIY G FTPTE+A VA Y FV F+++++ K KD Sbjct: 243 PLIILGGIYSGFFTPTESAVVAIFYTLFVGIFLHKEL-------KLKD------------ 283 Query: 284 GQTVVYFIPSFFHADTRHALFEAGKLTVTLLFVIANALILKHVLTDEQVPQQIATAMLSA 343 FFH+ L +T +L ++ A + +L + Q+P +A A+L Sbjct: 284 ----------FFHS-----LETTTWITGRVLLILFTATVFGRLLVENQIPAIVAEALLDF 328 Query: 344 GFGPVMFLIVVNVILLIGGQFMEPSGLLVIVAPLVFPIAIELGIDPIHLGIIMVVNMEIG 403 + ++ L+ G FME ++I+ P++ PI LG+DP+H G++MV + IG Sbjct: 329 TSNMYLIWALIIAFLVFVGMFMETLATIMILTPVLLPIMYSLGVDPVHFGVVMVATLAIG 388 Query: 404 MITPPVGLNLFVTSGVAGMPMMAVVRAALPFLAVLFVFLIMITYIPWISTVLP 456 TPP+G NLFV SG+ G + + A+PF + + + +I Y+P +S LP Sbjct: 389 FQTPPLGENLFVASGIGGSTIEDISVKAMPFSILAIIAIFIIAYVPQLSLFLP 441 Lambda K H 0.329 0.144 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 584 Number of extensions: 42 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 467 Length of database: 446 Length adjustment: 33 Effective length of query: 434 Effective length of database: 413 Effective search space: 179242 Effective search space used: 179242 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory