Align ornithine aminotransferase (EC 2.6.1.13) (characterized)
to candidate WP_028583710.1 G494_RS0105395 adenosylmethionine--8-amino-7-oxononanoate transaminase
Query= BRENDA::B1A0U3 (469 letters) >NCBI__GCF_000429965.1:WP_028583710.1 Length = 429 Score = 164 bits (415), Expect = 5e-45 Identities = 135/432 (31%), Positives = 205/432 (47%), Gaps = 41/432 (9%) Query: 32 SSQTIIDKEHQHSAHNY----HPLPIV-FAHAKGSSVWDPEGNKYIDFLSGYSAVNQGHC 86 S Q+++D + +H H Y PLP+ A A G + +G ID +S + +V G+C Sbjct: 2 SDQSLLDFDREHLWHPYTSMTQPLPVFPVASAAGVRLTLEDGQTLIDGMSSWWSVIHGYC 61 Query: 87 HPKILKALHDQADRLT-VSSRAFYNDRFPVFAEYLTALFG--YDMVLPMNTGAEGVETAL 143 HP + +A H+Q DR++ V + L A+ D V ++G+ VE AL Sbjct: 62 HPVLDRAAHEQLDRMSHVMFGGLTHGPAVELGRRLVAISPEPLDKVFLCDSGSVSVEVAL 121 Query: 144 KLARKWGYEKKKIPNDEALIVSCCGCFNGRTLGVISMSCDNEATRGFGPLMPGHLKVDF- 202 K+A ++ + K L + G ++G T +S+ CD G L G L Sbjct: 122 KMALQYWHSLGKPRKHRLLTIR--GGYHGDTFHAMSV-CD--PVNGMHSLFEGALPKQLF 176 Query: 203 --------------GDAEAIERIFKEKGDRVAAFILEP-IQGEAGVVIPPDGYLKAVRDL 247 D E +ER+ +E +AA I+EP +QG G+ I YLK +R L Sbjct: 177 APRPSCRYDQQWQAEDLEEMERLLEEHHQELAAVIVEPLVQGAGGMWIYHPDYLKGLRSL 236 Query: 248 CSKYNVLMIADEIQTGLARTGKMLACDWEDVRPDVVILGKALGGGILPVSAVLADKDVML 307 C Y VL+I DEI TG RTG+M A D + PD++ +GKA+ GG + ++A LA ++ + Sbjct: 237 CDSYGVLLICDEIATGFGRTGRMFAVDHAGIAPDIMCVGKAITGGYMTLAATLATTEIAV 296 Query: 308 CIKPG-----QHGSTFGGNPLASAVAIAALEVIKEERLTERSTKLGGELLGLLHKIQKKH 362 I G HG TF GNPLA AVA A+L ++++E ER + +L L + Sbjct: 297 TISKGASGVFMHGPTFMGNPLACAVASASLGLLQDEPWQERVGAIEAQLTAEL--APARA 354 Query: 363 PEHVKEVRGKGLFIGVELNSESLSPVSGFELSEKLKERGVLAKSTHDTIIRFTPPLCISA 422 V +VR G VEL PV L E+GV + ++ PP IS Sbjct: 355 LSTVSDVRVLGGIGVVELK----EPVDMARLQRFFVEQGVWIR-PFGRLLYIMPPYIISP 409 Query: 423 DEIQQGSKALAE 434 +++ ++ L E Sbjct: 410 EDLSTLTRVLVE 421 Lambda K H 0.319 0.137 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 469 Number of extensions: 23 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 469 Length of database: 429 Length adjustment: 33 Effective length of query: 436 Effective length of database: 396 Effective search space: 172656 Effective search space used: 172656 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory