Align Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.8 (characterized)
to candidate WP_028583718.1 G494_RS0105455 phosphate acetyltransferase
Query= SwissProt::P77844 (329 letters) >NCBI__GCF_000429965.1:WP_028583718.1 Length = 702 Score = 363 bits (932), Expect = e-105 Identities = 184/325 (56%), Positives = 239/325 (73%) Query: 1 MSAELFENWLLKRARAEHSHIVLPEGDDDRILMAAHQLLDQDICDITILGDPVKIKERAT 60 MS +FE L +RARA HIVLPEGDDDRIL AA L +D+ ++TILG+ +I RAT Sbjct: 368 MSPLMFEYSLFERARASKQHIVLPEGDDDRILRAAEILRLRDVAELTILGNRAEICNRAT 427 Query: 61 ELGLHLNTAYLVNPLTDPRLEEFAEQFAELRKSKSVTIDEAREIMKDISYFGTMMVHNGD 120 +LGL L ++P P EEFA +R + ++++ A + + ++SYFGTMMVH G Sbjct: 428 QLGLKLPGVRFIDPHHSPLREEFAATLYTMRSHRGMSMEYAHDRITNVSYFGTMMVHEGL 487 Query: 121 ADGMVSGAANTTAHTIKPSFQIIKTVPEASVVSSIFLMVLRGRLWAFGDCAVNPNPTAEQ 180 ADGMVSGAA+TT HTI+P+FQ+I+T P+ +VSS+F M L ++ +GDCAVNPNP +E+ Sbjct: 488 ADGMVSGAAHTTQHTIQPAFQLIRTAPDVLMVSSVFFMCLDTKVLVYGDCAVNPNPDSEE 547 Query: 181 LGEIAVVSAKTAAQFGIDPRVAILSYSTGNSGGGSDVDRAIDALAEARRLNPELCVDGPL 240 L EIA+ SA TAA F ++P +A+LSYS+G+SG GSDVD A+ A+ P+L +DGP+ Sbjct: 548 LAEIAISSADTAAMFNLEPVIAMLSYSSGSSGQGSDVDLVRQAVRLAQERRPDLLIDGPI 607 Query: 241 QFDAAVDPGVARKKMPDSDVAGQANVFIFPDLEAGNIGYKTAQRTGHALAVGPILQGLNK 300 Q+DAA+D VARKKMP+S VAG+A V IFPDL GN YK QR+ A+A+GP+LQGLNK Sbjct: 608 QYDAAIDATVARKKMPESAVAGRATVLIFPDLNTGNNTYKAVQRSSGAVAIGPVLQGLNK 667 Query: 301 PVNDLSRGATVPDIVNTVAITAIQA 325 PVNDLSRG VPDI+NTVAITAIQA Sbjct: 668 PVNDLSRGCLVPDIINTVAITAIQA 692 Lambda K H 0.318 0.134 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 563 Number of extensions: 22 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 329 Length of database: 702 Length adjustment: 34 Effective length of query: 295 Effective length of database: 668 Effective search space: 197060 Effective search space used: 197060 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
Align candidate WP_028583718.1 G494_RS0105455 (phosphate acetyltransferase)
to HMM TIGR00651 (pta: phosphate acetyltransferase (EC 2.3.1.8))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00651.hmm # target sequence database: /tmp/gapView.30316.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00651 [M=304] Accession: TIGR00651 Description: pta: phosphate acetyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-124 400.7 0.0 3.4e-124 400.2 0.0 1.2 1 lcl|NCBI__GCF_000429965.1:WP_028583718.1 G494_RS0105455 phosphate acetylt Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000429965.1:WP_028583718.1 G494_RS0105455 phosphate acetyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 400.2 0.0 3.4e-124 3.4e-124 1 304 [] 388 689 .. 388 689 .. 0.99 Alignments for each domain: == domain 1 score: 400.2 bits; conditional E-value: 3.4e-124 TIGR00651 1 ivlPEgseervlkAaallaekkiaekvllvnkeeevknkakevnlklgkvvvedpdvskdiekyverly 69 ivlPEg++ r+l+Aa++l +++ae ++l+n +e+ + +a+++ lkl v+ +dp+ s+ +e+++ +ly lcl|NCBI__GCF_000429965.1:WP_028583718.1 388 IVLPEGDDDRILRAAEILRLRDVAELTILGNRAEICN-RATQLGLKLPGVRFIDPHHSPLREEFAATLY 455 8****************************99998887.9****************************** PP TIGR00651 70 ekrkhkGvtekeareqlrDevslaallvelgeadglvsGavsttaktlrpalqiiktlegvklvssvfi 138 r h+G++++ a++ +++ +++++++v+ g adg+vsGa++tt++t++pa+q+i+t++ v +vssvf+ lcl|NCBI__GCF_000429965.1:WP_028583718.1 456 TMRSHRGMSMEYAHDRITNVSYFGTMMVHEGLADGMVSGAAHTTQHTIQPAFQLIRTAPDVLMVSSVFF 524 ********************************************************************* PP TIGR00651 139 mekeeevlvfaDCavavdPnaeeLAeiAlqsaksakslgeeepkvallsystkgsgkgeevekvkeAvk 207 m+++ +vlv++DCav+++P++eeLAeiA++sa++a +++ ep +a+lsys+++sg+g++v+ v++Av+ lcl|NCBI__GCF_000429965.1:WP_028583718.1 525 MCLDTKVLVYGDCAVNPNPDSEELAEIAISSADTAAMFN-LEPVIAMLSYSSGSSGQGSDVDLVRQAVR 592 **************************************9.***************************** PP TIGR00651 208 ilkekepdllldGelqfDaAlvekvaekkapesevagkanvfvFPdLdaGnigYkivqRladaeaiGPi 276 +++e++pdll+dG++q+DaA+ ++va+kk+pes+vag+a+v++FPdL++Gn++Yk+vqR+++a aiGP+ lcl|NCBI__GCF_000429965.1:WP_028583718.1 593 LAQERRPDLLIDGPIQYDAAIDATVARKKMPESAVAGRATVLIFPDLNTGNNTYKAVQRSSGAVAIGPV 661 ********************************************************************* PP TIGR00651 277 lqGlakPvnDLsRGasvedivnvviita 304 lqGl+kPvnDLsRG++v di+n+v+ita lcl|NCBI__GCF_000429965.1:WP_028583718.1 662 LQGLNKPVNDLSRGCLVPDIINTVAITA 689 **************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (304 nodes) Target sequences: 1 (702 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 19.98 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory