Align Transmembrane component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate WP_028583915.1 G494_RS0106725 branched-chain amino acid ABC transporter permease
Query= uniprot:Q1MCU0 (300 letters) >NCBI__GCF_000429965.1:WP_028583915.1 Length = 296 Score = 136 bits (343), Expect = 5e-37 Identities = 89/296 (30%), Positives = 151/296 (51%), Gaps = 17/296 (5%) Query: 2 EYFVQQLLNGLTLGSIYGLVAIGYTMVYGIIGMINFAHGDIFMLGGFAALIVFLVLTSIF 61 + F Q L G+T G+IY +VAIG+ ++Y G+INFA G+ MLGG A+ + V+ Sbjct: 4 DLFFQYLFAGVTYGAIYAIVAIGFNIIYNTTGIINFAQGEFVMLGGMIAISLHQVMP--- 60 Query: 62 AGLPVAVLLLVMLVVAMLMTSLWNWTIERVAYRPLRGSFRLAPLITAIGMSITLSNFIQV 121 LP+A+ L A+ +T + IE + R L+ L +I IG+SI L Sbjct: 61 --LPLAITL------AVALTMVIGAAIEIIFIRWLQSPSVLRLIIITIGVSILLREAALH 112 Query: 122 TQGPRNKPIPPM----VSSVYQFGNISVSLKQIIIIVITAVLLTIFWYIVNRTALGRAQR 177 G + +P +SS+ G++ +S + + +I +++ T GR R Sbjct: 113 IWGESIRSLPYFYGNEISSI-SLGSVHLSPQVLWVIAACGIMVAGLSLFFKYTPTGREMR 171 Query: 178 ATEQDRKMAALLGVNVDQTISITFVMGAALAAVAGTMYLMYYGVASFNDGFTPGVKAFTA 237 A +R A L G++ ++++F++ A + AVAG + + ++ G +K FT Sbjct: 172 ACSANRTAAILCGISTRNMVTLSFMLSAGIGAVAGCV-MSPITYTQYDSGTGLAIKGFTV 230 Query: 238 AVLGGIGSLPGAVFGGLLIGLIESLWSAYFTIAYKDVATFAILAFVLIFKPTGILG 293 A+LGG+G+ AV G+L+G+IE+ + +A++D IL +L KP G+ G Sbjct: 231 AILGGLGNSMAAVAAGILLGIIEAFSVSVVPLAFQDAIAITILLAILFVKPHGLFG 286 Lambda K H 0.329 0.143 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 266 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 300 Length of database: 296 Length adjustment: 26 Effective length of query: 274 Effective length of database: 270 Effective search space: 73980 Effective search space used: 73980 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory