Align Glucokinase; EC 2.7.1.2; Glucose kinase (uncharacterized)
to candidate WP_028584011.1 G494_RS0107335 glucokinase
Query= curated2:B2J224 (341 letters) >NCBI__GCF_000429965.1:WP_028584011.1 Length = 326 Score = 214 bits (545), Expect = 2e-60 Identities = 128/336 (38%), Positives = 185/336 (55%), Gaps = 18/336 (5%) Query: 3 LLLAGDIGGTKTILQLVETSDSQG-LHTIYQESYHSADFPDLVPIVQQFLIKANTPIPEK 61 +LLAGDIGGTKT L + S QG + +Y S L IV+ FL+ + ++ Sbjct: 1 MLLAGDIGGTKTRLGIF--SREQGPFKPLAACTYSSTSHGGLEDIVRAFLLDTGYTV-KR 57 Query: 62 ACFAIAGPIVKNTAKLTNLAWFLDTERLQQELGIPHIYLINDFAAVGYGISGLQKQDLHP 121 ACF +AGP+ N A +TNL W +D L QE+GI + L+ND A+ + + L + Sbjct: 58 ACFGVAGPVKDNAATITNLPWLIDGNTLAQEVGIDEVCLLNDLEAMAHAVPLLSGTSMEV 117 Query: 122 LQVGKPQPETPIGIIGAGTGLGQGFLIKQGNNYQVFPSEGGHADFAPRNEIEFQLLKYLL 181 + G+ + + ++ GTGLG+ FL G+ Y+ SEGGH +F PR +IE +LL YL Sbjct: 118 VSPGEAEAQGVKALVAPGTGLGEVFLSWNGSKYRAHRSEGGHTEFGPRTDIESELLSYL- 176 Query: 182 DKHDIQRISVERVVSGMGIVAIYQFLRDRKFAAESPDIAQIVRTWEQEAGQEEKSVDPGA 241 +H +S ERV SGM I +Y F RD E P +A+ Q +++ DP Sbjct: 177 -RHRYDHVSYERVCSGMAIPDLYAFFRDTGRYPEPPGLAE----------QLKRADDPTP 225 Query: 242 AIGTAAL--EKRDRLSEQTLQLFIEAYGAEAGNLALKLLPYGGLYIAGGIAPKILPLIQN 299 I AAL +++ + ++LF+ GAEAGNLAL + YGG+YI GGI P+I I + Sbjct: 226 LIIEAALCFPEKNPICVAVVELFVSVLGAEAGNLALTVSAYGGIYIGGGIPPRIAHYIHS 285 Query: 300 SGFLLNFTQKGRMRPLLEEIPVYIILNPQVGLIGAA 335 F+ KGR+ P++ +IPVY+I L GAA Sbjct: 286 PLFIRTLKDKGRLSPMVSDIPVYLITLDDTALTGAA 321 Lambda K H 0.320 0.140 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 301 Number of extensions: 21 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 341 Length of database: 326 Length adjustment: 28 Effective length of query: 313 Effective length of database: 298 Effective search space: 93274 Effective search space used: 93274 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_028584011.1 G494_RS0107335 (glucokinase)
to HMM TIGR00749 (glk: glucokinase (EC 2.7.1.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00749.hmm # target sequence database: /tmp/gapView.28865.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00749 [M=315] Accession: TIGR00749 Description: glk: glucokinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.5e-77 245.3 0.0 5.3e-77 245.1 0.0 1.0 1 lcl|NCBI__GCF_000429965.1:WP_028584011.1 G494_RS0107335 glucokinase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000429965.1:WP_028584011.1 G494_RS0107335 glucokinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 245.1 0.0 5.3e-77 5.3e-77 1 315 [] 3 321 .. 3 321 .. 0.93 Alignments for each domain: == domain 1 score: 245.1 bits; conditional E-value: 5.3e-77 TIGR00749 1 lvgdiGGtnarlalv..evapgeieqvktyssedfpsleavvrvyleeakvelkdpikgcfaiatPiig 67 l+gdiGGt++rl++ e p + ++ tyss+ + le++vr +l ++ ++k +cf +a+P+ + lcl|NCBI__GCF_000429965.1:WP_028584011.1 3 LAGDIGGTKTRLGIFsrEQGPFKPLAACTYSSTSHGGLEDIVRAFLLDTGYTVKR---ACFGVAGPVKD 68 79************95555555555569**************************9...*********** PP TIGR00749 68 dfvrltnldWalsieelkqelalaklelindfaavayailalkeedliqlggakveesaaiailGaGtG 136 + +tnl W + +++l+qe+++ ++ l+nd+ a+a a++ l + ++ ++e ++ +a++ +GtG lcl|NCBI__GCF_000429965.1:WP_028584011.1 69 NAATITNLPWLIDGNTLAQEVGIDEVCLLNDLEAMAHAVPLLSGTSMEVVSPGEAEAQGVKALVAPGTG 137 ********************************************************************* PP TIGR00749 137 lGvatliqqsdgrykvlageGghvdfaPrseleillleylrkkygrvsaervlsGsGlvliyealskrk 205 lG +l ++ +y++ +eGgh++f Pr + e ll ylr++y++vs erv sG+ + +y +++ lcl|NCBI__GCF_000429965.1:WP_028584011.1 138 LGEVFLSWNG-SKYRAHRSEGGHTEFGPRTDIESELLSYLRHRYDHVSYERVCSGMAIPDLYAFFRDTG 205 *****99965.67****************************************************9876 PP TIGR00749 206 gere....vsklskeelkekdiseaal..egsdvlarralelflsilGalagnlalklgarGGvyvaGG 268 e ++l++++ i eaal ++++++ +elf+s+lGa+agnlal++ a+GG+y+ GG lcl|NCBI__GCF_000429965.1:WP_028584011.1 206 RYPEppglAEQLKRADDPTPLIIEAALcfPEKNPICVAVVELFVSVLGAEAGNLALTVSAYGGIYIGGG 274 666633545566666555556999999445899************************************ PP TIGR00749 269 ivPrfiellkkssfraafedkGrlkellasiPvqvvlkkkvGllGag 315 i Pr+ +++++ f +++dkGrl ++++iPv+++ +++ l Ga+ lcl|NCBI__GCF_000429965.1:WP_028584011.1 275 IPPRIAHYIHSPLFIRTLKDKGRLSPMVSDIPVYLITLDDTALTGAA 321 *********************************************96 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (315 nodes) Target sequences: 1 (326 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 9.15 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory