Align 3-hydroxy-2-methylbutyryl-CoA dehydrogenase subunit (EC 1.1.1.178) (characterized)
to candidate WP_028584022.1 G494_RS0107415 3-oxoacyl-ACP reductase FabG
Query= metacyc::MONOMER-11802 (255 letters) >NCBI__GCF_000429965.1:WP_028584022.1 Length = 245 Score = 95.9 bits (237), Expect = 7e-25 Identities = 75/250 (30%), Positives = 122/250 (48%), Gaps = 24/250 (9%) Query: 9 IVSGAASGLGAATAQMLVEAGAKVMLVDLN----AQAVEAKARELGDNARFAVADISDEQ 64 IV+G + G+G A L G ++ + AQ A+ G A D+ D + Sbjct: 11 IVTGGSKGIGRAICLELARQGHYCVINYHSDREGAQTTLARVEAAGGAGEIAPLDVRDTE 70 Query: 65 AAQSAVDAAVSAFGSLHGLVNCAGIV--GAEKVLGKQGPHGLASFAKVINVNLIGSFNLL 122 AA+ AV+ S G + LVN AGI+ G ++ +Q S+ VI+ +L G +N+ Sbjct: 71 AAREAVEELASRLGRIDLLVNNAGIISDGLFMMMSQQ------SWQTVIDTSLNGFYNVT 124 Query: 123 RLAAAAMAEGAADESGERGVIINTASIAAYDGQIGQAAYAASKGAIASLTLPAARELARF 182 R M RG +++ +S ++ GQA YAA+K + + + A E+AR Sbjct: 125 RPVIEQMVRR------RRGAVVSLSSASSLMPNRGQANYAAAKAGLNAASKALASEVARL 178 Query: 183 GIRVMTIAPGIFETPMMAGMSDEVRASLAAGVPFPPRLGRPQEYAALARHIIEN--SMLN 240 GIRV +APG+ ET M + + R + A +P R+GRP+E A + + S + Sbjct: 179 GIRVNVVAPGLIETQM---IQEAPREQIKAMIPM-ARIGRPEEVAQVVGFLCSEAASYVT 234 Query: 241 GEVIRLDGAL 250 G+VI ++G + Sbjct: 235 GQVISVNGGM 244 Lambda K H 0.318 0.131 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 120 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 245 Length adjustment: 24 Effective length of query: 231 Effective length of database: 221 Effective search space: 51051 Effective search space used: 51051 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory