Align acetyl-CoA C-acetyltransferase [EC: 2.3.1.9] (characterized)
to candidate WP_028584037.1 G494_RS0107490 acetyl-CoA C-acyltransferase
Query= reanno::pseudo5_N2C3_1:AO356_21640 (393 letters) >NCBI__GCF_000429965.1:WP_028584037.1 Length = 395 Score = 338 bits (866), Expect = 2e-97 Identities = 192/391 (49%), Positives = 247/391 (63%), Gaps = 2/391 (0%) Query: 2 QEVVIVAATRTAIGSFQGSLAAIPAPELGAAVIRRLLEQTGLSGEQVDEVILGQVLTAGS 61 Q++ IV A RT GSF GSLA +PAPEL AAVI LL ++GL G VDEVI+GQVL G Sbjct: 6 QDIFIVEALRTPFGSFLGSLAEVPAPELAAAVIPELLGRSGLGGTLVDEVIIGQVLQGGC 65 Query: 62 GQNPARQASILAGLPHAVPALTLNKVCGSGLKALHLGAQAIRCGDAEVIIAGGMENMSLA 121 GQ PARQA LAGLP V ALT+NKVCGSGL A+ L A IR G+A ++IAGGMENMSLA Sbjct: 66 GQAPARQAMRLAGLPDQVHALTINKVCGSGLVAMMLAANTIRAGEASLVIAGGMENMSLA 125 Query: 122 PYVLPAARTGLRMGHAKMIDSMITDGLWDAFNDYHMGITAENLVDKYGISREEQDAFAAA 181 P+VL AR G R GH +++D ++ DGL DA + MG E + + ISR EQDA+A Sbjct: 126 PHVLARARKGQRFGHGEILDLLLLDGLEDAASGRSMGEITEEWLRGHRISRREQDAYALR 185 Query: 182 SQQKAVAAIEGGRFADEITPILIPQRKGDPVAFATDEQPRAGTTAESLGKLKPAFKKDGS 241 S A A++ FA E+ + KG V A DE+P E L F++ GS Sbjct: 186 SYGLAQQALKEQIFAPELVEVRFNSGKGWLVV-AEDEEPWR-CDPEKFASLPTVFREQGS 243 Query: 242 VTAGNASSLNDGAAAVILMSAEKAKALGLPVLAKISAYANAGVDPAIMGIGPVSATRRCL 301 +TAGNAS++NDGAA ++ + GL A++ A A A P + V A R + Sbjct: 244 ITAGNASTINDGAALALVAGGAAVERYGLRPRARLVAAATASTGPQLFPEADVEAIRLAV 303 Query: 302 DKAGWSLEQLDLIEANEAFAAQSLAVARELKWDMDKVNVNGGAIALGHPIGASGCRVLVS 361 +AG SLE +DL E NEAFAA +L L D +VNVNGGA+A+GHPIGASG R++ + Sbjct: 304 ARAGLSLEDIDLFEINEAFAAVALLTMELLAIDPARVNVNGGAVAIGHPIGASGGRLVAT 363 Query: 362 LLHEMIKRDAKKGLATLCIGGGQGVALALER 392 L+ E+ +++ + G+ TLCIGGG+ VA ER Sbjct: 364 LIRELERQEKRYGVVTLCIGGGEAVAAVFER 394 Lambda K H 0.317 0.133 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 446 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 395 Length adjustment: 31 Effective length of query: 362 Effective length of database: 364 Effective search space: 131768 Effective search space used: 131768 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory