Align dihydrolipoyl dehydrogenase (EC 1.8.1.4) (characterized)
to candidate WP_028584055.1 G494_RS0107595 dihydrolipoyl dehydrogenase
Query= BRENDA::P0A9P0 (474 letters) >NCBI__GCF_000429965.1:WP_028584055.1 Length = 473 Score = 389 bits (1000), Expect = e-113 Identities = 207/466 (44%), Positives = 302/466 (64%), Gaps = 8/466 (1%) Query: 5 IKTQVVVLGAGPAGYSAAFRCADLGLETVIVERYNTLGGVCLNVGCIPSKALLHVAKVIE 64 + TQV+V+G+GP GY AAFR ADLGLE +V+ GGVCL GCIPSK L ++++I+ Sbjct: 6 VDTQVLVIGSGPGGYGAAFRAADLGLEVTLVDPAPRPGGVCLFQGCIPSKTFLFLSELID 65 Query: 65 EAKALAEHGIVFGEPKTDIDKIRTWKEKVINQLTGGLAGMAKGRKVKVVNGLGKFTGANT 124 +A+ + G+ F EP D+ ++R W+E+V++ + GL + R +++++G +F A+T Sbjct: 66 DARRASAMGVSFAEPSIDLARVRAWREQVVDSMAKGLTTLCARRGIELISGKARFESADT 125 Query: 125 LEVEGENGKTVINFDNAIIAAGSRPIQLPFIPH-EDPRIWDSTDALELKEVPERLLVMGG 183 + VE + I F AIIA GS P+ LP +P D RI DS+ AL L ++PERLLV+GG Sbjct: 126 VFVEDAAVRR-IQFRQAIIATGSHPLALPGVPLVADGRIMDSSGALALADIPERLLVIGG 184 Query: 184 GIIGLEMGTVYHALGSQIDVVEMFDQVIPAADKDIVKVFTKRISKKFN-LMLETKVTAVE 242 G IGLE+G++Y LGS++ +VE+ D+++ D+D+V +R+ + F+ + L+T+VT ++ Sbjct: 185 GYIGLELGSLYAGLGSRVRLVELSDRLLGGVDRDLVLPLQRRLEQAFDSIRLQTRVTGLK 244 Query: 243 AKEDGIYVTME--GKKAPAEPQRYDAVLVAIGRVPNGKNLDAGKAGVEVDDRGFIRVDKQ 300 D + V++E G+ + +R VLVAIGR N L +AGV V G I VD+Q Sbjct: 245 ECADQVEVSLEIDGRTSTESVER---VLVAIGRAANSDGLGLDRAGVRVGPGGEIVVDEQ 301 Query: 301 LRTNVPHIFAIGDIVGQPMLAHKGVHEGHVAAEVIAGKKHYFDPKVIPSIAYTEPEVAWV 360 RTNV IFA+GD+ G MLAH +G VAAEVIAG+ FD + +P++ YT+P+VAW Sbjct: 302 QRTNVAQIFAVGDVCGGMMLAHTATRQGKVAAEVIAGQASAFDVRAVPAVVYTDPQVAWC 361 Query: 361 GLTEKEAKEKGISYETATFPWAASGRAIASDCADGMTKLIFDKESHRVIGGAIVGTNGGE 420 GL+E++A++ + FPW SGRA DG+TKL+ D ES R++G I G + Sbjct: 362 GLSEEQARQNKLPVRVERFPWKYSGRAATMGATDGLTKLLVDPESGRILGLGITGRDAEG 421 Query: 421 LLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEVFEGSITDL 466 L+ E LAIEMG AED+AL+IH HPTL E+ AAE++ GS T L Sbjct: 422 LIAEGVLAIEMGALAEDLALSIHPHPTLSETEAEAAELYSGSATHL 467 Lambda K H 0.317 0.137 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 558 Number of extensions: 24 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 474 Length of database: 473 Length adjustment: 33 Effective length of query: 441 Effective length of database: 440 Effective search space: 194040 Effective search space used: 194040 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
Align candidate WP_028584055.1 G494_RS0107595 (dihydrolipoyl dehydrogenase)
to HMM TIGR01350 (lpdA: dihydrolipoyl dehydrogenase (EC 1.8.1.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01350.hmm # target sequence database: /tmp/gapView.8978.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01350 [M=461] Accession: TIGR01350 Description: lipoamide_DH: dihydrolipoyl dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.2e-142 459.4 0.0 7.1e-142 459.2 0.0 1.0 1 lcl|NCBI__GCF_000429965.1:WP_028584055.1 G494_RS0107595 dihydrolipoyl deh Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000429965.1:WP_028584055.1 G494_RS0107595 dihydrolipoyl dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 459.2 0.0 7.1e-142 7.1e-142 3 460 .. 9 466 .. 7 467 .. 0.97 Alignments for each domain: == domain 1 score: 459.2 bits; conditional E-value: 7.1e-142 TIGR01350 3 dvvviGgGpgGYvaAiraaqlglkvalvek.eklGGtClnvGCiPtKalLksaevveelkeakelgiev 70 +v+viG+GpgGY aA raa lgl+v+lv+ + GG+Cl +GCiP+K++L +e++++++ a+ +g++ lcl|NCBI__GCF_000429965.1:WP_028584055.1 9 QVLVIGSGPGGYGAAFRAADLGLEVTLVDPaPRPGGVCLFQGCIPSKTFLFLSELIDDARRASAMGVSF 77 799**************************9899************************************ PP TIGR01350 71 envkldlekllerkekvvkklvgGvkaLlkknkvevikGeaklldkkevevkkekkekkleakniiiAt 139 ++ ++dl+++ +++e+vv+++++G+++L+ + ++e i+G+a+++++++v v++ + + +++ ++iiAt lcl|NCBI__GCF_000429965.1:WP_028584055.1 78 AEPSIDLARVRAWREQVVDSMAKGLTTLCARRGIELISGKARFESADTVFVEDAAV-RRIQFRQAIIAT 145 ******************************************************96.5*********** PP TIGR01350 140 Gseprelplk.leedekvvitseealelkevpeslvivGgGviGvEfasifaklGvkvtvielldrilp 207 Gs+p +lp+ l +d+ ++++s++al+l +pe+l+++GgG+iG+E++s++a lG+ v ++el+dr+l lcl|NCBI__GCF_000429965.1:WP_028584055.1 146 GSHPLALPGVpLVADG-RIMDSSGALALADIPERLLVIGGGYIGLELGSLYAGLGSRVRLVELSDRLLG 213 *********8755665.7*************************************************** PP TIGR01350 208 aldaevskvlkkklkkkgvkiltnakvtevekeedevvveakkk.evetleaekvLvavGrkpnleelg 275 +d+++ l+++l++ +i +++vt +++ +d+v+v+ + + ++t ++e+vLva+Gr +n ++lg lcl|NCBI__GCF_000429965.1:WP_028584055.1 214 GVDRDLVLPLQRRLEQAFDSIRLQTRVTGLKECADQVEVSLEIDgRTSTESVERVLVAIGRAANSDGLG 282 **************************************87776667999******************** PP TIGR01350 276 leklgveldergaikvdeelrtnvpgiyaiGDvigklmLAhvAskegvvaaekiagkekseidykavPs 344 l++ gv++ g i+vde+ rtnv++i+a+GDv g++mLAh+A+++g vaae iag+++ ++d +avP+ lcl|NCBI__GCF_000429965.1:WP_028584055.1 283 LDRAGVRVGPGGEIVVDEQQRTNVAQIFAVGDVCGGMMLAHTATRQGKVAAEVIAGQAS-AFDVRAVPA 350 ********************************************************886.9******** PP TIGR01350 345 viytePevasvGlteeqakeegievkvgkfpfaangkalaleetdGfvkvivdkktgeilGahivgaea 413 v+yt+P+va Gl+eeqa++++ v+v +fp + +g+a +++ tdG+ k++vd+++g+ilG+ i g +a lcl|NCBI__GCF_000429965.1:WP_028584055.1 351 VVYTDPQVAWCGLSEEQARQNKLPVRVERFPWKYSGRAATMGATDGLTKLLVDPESGRILGLGITGRDA 419 ********************************************************************* PP TIGR01350 414 seliselalaveleltveelaktihpHPtlsEaikeaalaalgkaih 460 li+e +la+e+++ +e+la +ihpHPtlsE+ +eaa+ +g+a h lcl|NCBI__GCF_000429965.1:WP_028584055.1 420 EGLIAEGVLAIEMGALAEDLALSIHPHPTLSETEAEAAELYSGSATH 466 ***************************************99999887 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (461 nodes) Target sequences: 1 (473 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02 # Mc/sec: 9.35 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory