Align Methylmalonyl-CoA epimerase; DL-methylmalonyl-CoA racemase; EC 5.1.99.1 (characterized)
to candidate WP_028584322.1 G494_RS0109355 methylmalonyl-CoA epimerase
Query= SwissProt::O58010 (136 letters) >NCBI__GCF_000429965.1:WP_028584322.1 Length = 134 Score = 150 bits (380), Expect = 5e-42 Identities = 72/130 (55%), Positives = 97/130 (74%), Gaps = 1/130 (0%) Query: 6 KRIDHVGIAVKNLEEAIKIWEG-LGFKVEEIEEVPDQKVKVAVIKVGENRIELLEATTED 64 ++IDH+GIAV +++ + W G LG ++E E V +QKV A VGE+ +ELLE+T D Sbjct: 4 EKIDHLGIAVPSIDGGKEFWTGVLGLELEGSETVEEQKVTTAFFPVGESEVELLESTAPD 63 Query: 65 SPIAKFIEKRGEGIHHLAIRVENIESKLEELKQKGYKLIDEKPRVGAGGAKIAFIHPKSV 124 P+AKFIEK+G G H+A RV +IE L ELK+KG KLID+ PR+GAGGAKIAF+HPK+ Sbjct: 64 GPVAKFIEKKGAGFQHVAFRVADIEEALAELKEKGVKLIDQTPRIGAGGAKIAFLHPKAT 123 Query: 125 TGVLLELCER 134 G+L+ELC+R Sbjct: 124 GGILVELCQR 133 Lambda K H 0.317 0.138 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 111 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 136 Length of database: 134 Length adjustment: 15 Effective length of query: 121 Effective length of database: 119 Effective search space: 14399 Effective search space used: 14399 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 42 (20.8 bits)
Align candidate WP_028584322.1 G494_RS0109355 (methylmalonyl-CoA epimerase)
to HMM TIGR03081 (mce: methylmalonyl-CoA epimerase (EC 5.1.99.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03081.hmm # target sequence database: /tmp/gapView.228780.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03081 [M=129] Accession: TIGR03081 Description: metmalonyl_epim: methylmalonyl-CoA epimerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3e-50 156.2 0.0 3.4e-50 156.1 0.0 1.0 1 NCBI__GCF_000429965.1:WP_028584322.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000429965.1:WP_028584322.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 156.1 0.0 3.4e-50 3.4e-50 1 129 [] 5 132 .. 5 132 .. 0.99 Alignments for each domain: == domain 1 score: 156.1 bits; conditional E-value: 3.4e-50 TIGR03081 1 kldhvaiavkdleeaaklyrdvlGakvseeeelpeqgvkvvflelgetklellepleedspiakflekkkgeG 73 k+dh++iav++++ +++++ vlG++++ +e+++eq+v+++f+ +ge+++elle+++ d+p+akf+ekk g G NCBI__GCF_000429965.1:WP_028584322.1 5 KIDHLGIAVPSIDGGKEFWTGVLGLELEGSETVEEQKVTTAFFPVGESEVELLESTAPDGPVAKFIEKK-GAG 76 79*******************************************************************.*** PP TIGR03081 74 lhhialevddieaaletlkekgvrlldeepriGahGkkvaFlhPkdtgGvLielee 129 h+a++v die+al++lkekgv+l+d++priGa+G+k+aFlhPk tgG+L+el++ NCBI__GCF_000429965.1:WP_028584322.1 77 FQHVAFRVADIEEALAELKEKGVKLIDQTPRIGAGGAKIAFLHPKATGGILVELCQ 132 ******************************************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (129 nodes) Target sequences: 1 (134 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 10.62 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory