Align Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.8 (characterized)
to candidate WP_028584418.1 G494_RS0109915 phosphate acetyltransferase
Query= SwissProt::P77844 (329 letters) >NCBI__GCF_000429965.1:WP_028584418.1 Length = 701 Score = 354 bits (909), Expect = e-102 Identities = 173/324 (53%), Positives = 238/324 (73%) Query: 2 SAELFENWLLKRARAEHSHIVLPEGDDDRILMAAHQLLDQDICDITILGDPVKIKERATE 61 S ++FE LLKRAR+ IVLPEG+++RIL AA L+ +D DI +LG P +I+ + +E Sbjct: 371 SPKMFEFGLLKRARSHKQLIVLPEGEEERILKAAEILIHRDAVDIILLGRPKEIRSKISE 430 Query: 62 LGLHLNTAYLVNPLTDPRLEEFAEQFAELRKSKSVTIDEAREIMKDISYFGTMMVHNGDA 121 GL L ++ P P +++A + +LR+ K +T D AR++M +++FGTMMV+ G A Sbjct: 431 FGLSLEGVEIIEPTASPHFDDYAATYFQLRRHKGITADNARDVMSGVNHFGTMMVYKGHA 490 Query: 122 DGMVSGAANTTAHTIKPSFQIIKTVPEASVVSSIFLMVLRGRLWAFGDCAVNPNPTAEQL 181 DGMVSGA ++T T++PS + +KT P ++++SS+F M L R+ A+ DCAVNP P+AEQL Sbjct: 491 DGMVSGAVHSTLQTVRPSLEFVKTKPGSTIMSSVFFMCLEDRVLAYADCAVNPRPSAEQL 550 Query: 182 GEIAVVSAKTAAQFGIDPRVAILSYSTGNSGGGSDVDRAIDALAEARRLNPELCVDGPLQ 241 EIA+ ++KTA+ FGI P VA+LSYS+G+SG G +VD+ +A A+ PEL ++GP+Q Sbjct: 551 AEIAIETSKTASLFGIKPLVAMLSYSSGSSGRGEEVDKVKEATRIAQERAPELLLEGPIQ 610 Query: 242 FDAAVDPGVARKKMPDSDVAGQANVFIFPDLEAGNIGYKTAQRTGHALAVGPILQGLNKP 301 +DAAVD VAR KMP+S VAG+A VFIFPDL GN YK QR+ A+A+GPI+QGLN+P Sbjct: 611 YDAAVDAEVARTKMPESKVAGRATVFIFPDLNTGNNTYKAVQRSAGAVAIGPIMQGLNRP 670 Query: 302 VNDLSRGATVPDIVNTVAITAIQA 325 VNDLSRG +PDIVNTVAITAIQA Sbjct: 671 VNDLSRGCLIPDIVNTVAITAIQA 694 Lambda K H 0.318 0.134 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 517 Number of extensions: 25 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 329 Length of database: 701 Length adjustment: 34 Effective length of query: 295 Effective length of database: 667 Effective search space: 196765 Effective search space used: 196765 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
Align candidate WP_028584418.1 G494_RS0109915 (phosphate acetyltransferase)
to HMM TIGR00651 (pta: phosphate acetyltransferase (EC 2.3.1.8))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00651.hmm # target sequence database: /tmp/gapView.27823.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00651 [M=304] Accession: TIGR00651 Description: pta: phosphate acetyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-127 411.5 0.0 1.6e-127 411.1 0.0 1.2 1 lcl|NCBI__GCF_000429965.1:WP_028584418.1 G494_RS0109915 phosphate acetylt Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000429965.1:WP_028584418.1 G494_RS0109915 phosphate acetyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 411.1 0.0 1.6e-127 1.6e-127 1 304 [] 390 691 .. 390 691 .. 0.99 Alignments for each domain: == domain 1 score: 411.1 bits; conditional E-value: 1.6e-127 TIGR00651 1 ivlPEgseervlkAaallaekkiaekvllvnkeeevknkakevnlklgkvvvedpdvskdiekyverly 69 ivlPEg+eer+lkAa++l++++ ++ +ll++ +e+ + k++e+ l+l+ v++++p+ s++ ++y+ +++ lcl|NCBI__GCF_000429965.1:WP_028584418.1 390 IVLPEGEEERILKAAEILIHRDAVDIILLGRPKEIRS-KISEFGLSLEGVEIIEPTASPHFDDYAATYF 457 8******************************999988.******************************* PP TIGR00651 70 ekrkhkGvtekeareqlrDevslaallvelgeadglvsGavsttaktlrpalqiiktlegvklvssvfi 138 ++r+hkG+t +ar+ + + +++++v++g+adg+vsGav++t +t+rp+l+ +kt++g+ ++ssvf+ lcl|NCBI__GCF_000429965.1:WP_028584418.1 458 QLRRHKGITADNARDVMSGVNHFGTMMVYKGHADGMVSGAVHSTLQTVRPSLEFVKTKPGSTIMSSVFF 526 ********************************************************************* PP TIGR00651 139 mekeeevlvfaDCavavdPnaeeLAeiAlqsaksakslgeeepkvallsystkgsgkgeevekvkeAvk 207 m++e++vl +aDCav++ P+ae+LAeiA+++ k+a +g ++p va+lsys+++sg+geev+kvkeA++ lcl|NCBI__GCF_000429965.1:WP_028584418.1 527 MCLEDRVLAYADCAVNPRPSAEQLAEIAIETSKTASLFG-IKPLVAMLSYSSGSSGRGEEVDKVKEATR 594 **************************************9.***************************** PP TIGR00651 208 ilkekepdllldGelqfDaAlvekvaekkapesevagkanvfvFPdLdaGnigYkivqRladaeaiGPi 276 i++e++p+lll+G++q+DaA+ ++va+ k+pes+vag+a+vf+FPdL++Gn++Yk+vqR+a+a aiGPi lcl|NCBI__GCF_000429965.1:WP_028584418.1 595 IAQERAPELLLEGPIQYDAAVDAEVARTKMPESKVAGRATVFIFPDLNTGNNTYKAVQRSAGAVAIGPI 663 ********************************************************************* PP TIGR00651 277 lqGlakPvnDLsRGasvedivnvviita 304 +qGl++PvnDLsRG+++ divn+v+ita lcl|NCBI__GCF_000429965.1:WP_028584418.1 664 MQGLNRPVNDLSRGCLIPDIVNTVAITA 691 **************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (304 nodes) Target sequences: 1 (701 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 14.81 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory