Align C4-dicarboxylate-binding periplasmic protein DctP (characterized)
to candidate WP_028584554.1 G494_RS0110770 C4-dicarboxylate ABC transporter
Query= SwissProt::P37735 (333 letters) >NCBI__GCF_000429965.1:WP_028584554.1 Length = 331 Score = 171 bits (434), Expect = 2e-47 Identities = 110/326 (33%), Positives = 167/326 (51%), Gaps = 4/326 (1%) Query: 9 ALVGATALSLAL-SVPALAEPIVIKFSHVVAPDTPKGKGAAKFEELAEKYTNGAVDVEVY 67 ++V A AL L + + A A PIVIK +H P P G+ KF+EL E+ +NGA V+++ Sbjct: 6 SIVTAVALCLCMGAASAFAGPIVIKLAHPNVPQHPMGQAFIKFKELMEERSNGAFRVDIF 65 Query: 68 PNSQLYKDKEELEALQLGAVQMLAPSLAKFGPLGVQDFEVFDLPYIFKDYEALHKVTQGE 127 +S+ ++ LQL +QM + S P +F +FDLP++F DY + K+T G Sbjct: 66 DSSKFGNFDSVVQGLQLNMLQMGSASTPNLAPFS-DEFLIFDLPFLFPDYPSTDKITDGP 124 Query: 128 AGKMLLSKLEAKGITGLAFWDNGFK-IMSANTPLTMPDDFLGLKMRIQSSKVLEAEMNAL 186 G LE GI GL + + GF+ + + N +T +D GLK+R SK A + AL Sbjct: 125 IGMNATKALEKSGIIGLGYIEIGFRNLWNNNRAVTTLEDAKGLKIRSTPSKAHIATLKAL 184 Query: 187 GAVPQVMAFSEVYQALQTGVVDGTENPPSNMFTQKMNEVQKHATVSNHGYLGYAVIVNKQ 246 G P +++ EVY ALQ VDG + + + EV H T+ N + + V+++K+ Sbjct: 185 GMNPTPISWGEVYTALQQKTVDGIDIDLNLAWYNNFPEVNNHVTIVNSLFSPHLVMISKR 244 Query: 247 FWDGLPADVRTGLEKAMAESTDYANGIAKEENEKALQAMKDAGTTEFHELTAEERAAWEE 306 F D L + R L E Y + ++ ++ + +KD G T L+ EER W E Sbjct: 245 FLDSLSPENRELLLTTFEEVKLYERKLIRDGEKEIMAQLKDKGVT-VTVLSPEERKRWAE 303 Query: 307 VLTPVHDEMAERIGAETIAAVKAATA 332 V+ + ERIG E I KA A Sbjct: 304 ATAGVYAQFEERIGKELIERAKATMA 329 Lambda K H 0.314 0.130 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 238 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 333 Length of database: 331 Length adjustment: 28 Effective length of query: 305 Effective length of database: 303 Effective search space: 92415 Effective search space used: 92415 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory