Align Threonine dehydratase 2 biosynthetic, chloroplastic; SlTD2; Threonine deaminase 2; EC 4.3.1.17; EC 4.3.1.19 (characterized)
to candidate WP_028584884.1 G494_RS0112930 threonine ammonia-lyase, biosynthetic
Query= SwissProt::P25306 (595 letters) >NCBI__GCF_000429965.1:WP_028584884.1 Length = 502 Score = 372 bits (956), Expect = e-107 Identities = 215/494 (43%), Positives = 293/494 (59%), Gaps = 4/494 (0%) Query: 101 ILASPVYDVAIESPLELAEKLSDRLGVNFYIKREDKQRVFSFKLRGAYNMMSNLSREELD 160 IL S VY+ AIE+ L+ AE LS +LG +KRED+Q VFSFKLRGAYN +S LS E Sbjct: 8 ILTSRVYEAAIETSLDEAEALSQQLGNRILLKREDQQPVFSFKLRGAYNRISQLSLAERR 67 Query: 161 KGVITASAGNHAQGVALAGQRLNCVAKIVMPTTTPQIKIDAVRALGGDVVLYGKTFDEAQ 220 KGVITASAGNHAQGV A +L A +VMP TTP IKI AV+ GG+V L+G F EA Sbjct: 68 KGVITASAGNHAQGVVFAANQLGIRAVVVMPVTTPLIKIKAVKRYGGEVTLHGNNFSEAA 127 Query: 221 THALELSEKDGLKYIPPFDDPGVIKGQGTIGTEINRQLK-DIHAVFIPVGGGGLIAGVAT 279 A L+ + G+ +I PFDD VI GQGTIG E+ RQ + AVFIPVGGGGLIAGVA Sbjct: 128 EKAARLTRESGMVFIHPFDDELVIAGQGTIGDELLRQNPGPLDAVFIPVGGGGLIAGVAA 187 Query: 280 FFKQIAPNTKIIGVEPYGAASMTLSLHEGHRVKLSNVDTFADGVAVALVGEYTFAKCQEL 339 + K++ P +IIGVEP + +M SL G R+ L V FADGVAV VG TF C+ Sbjct: 188 YIKELRPEVRIIGVEPRDSDAMARSLEAGKRLLLPEVGVFADGVAVKQVGRLTFTLCRRY 247 Query: 340 IDGMVLVANDGISAAIKDVYDEGRNILETSGAVAIAGAAAYCEFYKIKNENIVAIASGAN 399 +D ++ V+ D + + IK +Y R+I+E +GA+ + G Y ++ ++AI SGAN Sbjct: 248 VDDIIRVSTDELCSGIKAIYQATRSIVEPAGALGMTGLLKYIRESGCSDQTLIAINSGAN 307 Query: 400 MDFSKLHKVTELAGLGSGKEALLATFMVEQQGSFKTFV-GLVGSLNFTELTYRFTSERKN 458 M+F +L V E +G +EAL A + E +GS K F LVG N TE YR +S R+ Sbjct: 308 MNFERLRYVAERTLIGEQQEALFAVTIPETRGSLKRFCHDLVGDRNITEFNYRLSS-REQ 366 Query: 459 ALILYRVNVDKESDLEKMIEDMKSSNMTTLNLSHNELVVDHLKHLVGG-SANISDEIFGE 517 A I +++ ++ + + ++ L+L+ N+L +H++++VGG S + E Sbjct: 367 AYIFVGISISHAAERAEFGRRLNAAGYHNLDLTDNDLAKNHIRYMVGGRSTEVGGERLFR 426 Query: 518 FIVPEKAETLKTFLDAFSPRWNITLCRYRNQGDINASLLMGFQVPQAEMDEFKNQADKLG 577 F PE L FLD NI+L YR QG +L+G + E + + D+LG Sbjct: 427 FWFPETPGALVRFLDGVGGERNISLFHYRMQGGDFGRVLIGLEGGGRGEGELEGRLDRLG 486 Query: 578 YPYELDNYNEAFNL 591 Y Y+ + N A+ L Sbjct: 487 YRYQEETANPAYRL 500 Lambda K H 0.317 0.135 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 671 Number of extensions: 32 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 595 Length of database: 502 Length adjustment: 36 Effective length of query: 559 Effective length of database: 466 Effective search space: 260494 Effective search space used: 260494 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory