Align triose-phosphate isomerase (EC 5.3.1.1) (characterized)
to candidate WP_028585663.1 G494_RS0118165 phosphoglycerate kinase
Query= BRENDA::P36204 (654 letters) >NCBI__GCF_000429965.1:WP_028585663.1 Length = 393 Score = 375 bits (964), Expect = e-108 Identities = 193/393 (49%), Positives = 274/393 (69%), Gaps = 6/393 (1%) Query: 5 TIRDVDLKGKRVIMRVDFNVPVKD-GVVQDDTRIRAALPTIKYALEQGAKVILLSHLGRP 63 T+ ++++ GKRV++RVDFNVP+ + G V DD RI+ ALPTIK LE+ AKVI+ +H+GRP Sbjct: 5 TLVELEVSGKRVLVRVDFNVPMTEAGEVADDLRIQTALPTIKLLLERQAKVIICTHMGRP 64 Query: 64 KGEPSPEFSLAPVAKRLSELLGKEVKFVPAVVGDEVKKAVEELKEGEVLLLENTRFHPGE 123 KGE P++SLAPVA+ L+ LL V P +G E + V + GEV++LEN R++ E Sbjct: 65 KGEKIPKYSLAPVAEYLAALLDLPVTMAPDCIGPEAEAVVAAMAPGEVVMLENLRYYQQE 124 Query: 124 TKNDPELAKFWASLADIHVNDAFGTAHRAHASNVGIAQFIPS-VAGFLMEKEIKFLSKVT 182 NDP+ A ASLA+++VNDAF +HRAHAS VGI + + + AG L+EKE+ + + Sbjct: 125 VDNDPDFAAQLASLAELYVNDAFAVSHRAHASVVGIPKLMTAKAAGLLLEKELAYFKRSC 184 Query: 183 YNPEKPYVVVLGGAKVSDKIGVITNLMEKADRILIGGAMMFTFLKALGKEVGSSRVEEDK 242 P++P V ++GGAKVS K+ + N++ + DR+++GGAM TFLK+ G EVG+S+VEED Sbjct: 185 DQPQRPLVAIVGGAKVSGKLEALENMLARVDRLILGGAMANTFLKSQGYEVGASKVEEDL 244 Query: 243 IDLAKELLEKAKEKGVEIVLPVDAVIAQKIEPGVEKKVVRIDDGIPEGWMGLDIGPETIE 302 ++ A LL++A+ + V++ LPVD V A++ P K V I D IP GWM LDIGP ++ Sbjct: 245 LESADRLLQEARRQQVKVYLPVDVVAAERFAPDAVAKQVTIQD-IPPGWMALDIGPASVL 303 Query: 303 LFKQKLSDAKTVVWNGPMGVFEIDDFAEGTKQVALAIAALTEKGAITVVGGGDSAAAVNK 362 F++ L+DAKT+VWNGPMG FE+D F+ GT +A +AA A++V GGGDS AA+ Sbjct: 304 CFQEVLADAKTIVWNGPMGAFEMDAFSRGTTAIAHCVAA---SHALSVTGGGDSNAAIKL 360 Query: 363 FGLEDKFSHVSTGGGASLEFLEGKELPGIASIA 395 G S++STGGGA L +EGKELPG+A++A Sbjct: 361 SGEAANISYMSTGGGAFLMLMEGKELPGVAALA 393 Lambda K H 0.317 0.137 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 575 Number of extensions: 35 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 654 Length of database: 393 Length adjustment: 34 Effective length of query: 620 Effective length of database: 359 Effective search space: 222580 Effective search space used: 222580 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory