Align Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.8 (characterized)
to candidate WP_028585908.1 G494_RS0119815 phosphate acetyltransferase
Query= SwissProt::P77844 (329 letters) >NCBI__GCF_000429965.1:WP_028585908.1 Length = 706 Score = 343 bits (879), Expect = 1e-98 Identities = 179/329 (54%), Positives = 237/329 (72%), Gaps = 4/329 (1%) Query: 1 MSAELFENWLLKRARAEHSHIVLPEGDDDRILMAAHQLLDQDICDITILGDPVKIKERAT 60 ++ +FE L+++A ++ HIVLPEG R+L AA +L + I D+T+LG +I +A Sbjct: 371 ITPRMFEYSLVEKASSDRQHIVLPEGLGQRMLQAADIILRRGIADLTLLGRKDEIATKAA 430 Query: 61 ELGLHLNTAYLVNPLTDPRLEEFAEQFAELRKSKSVTIDEAREIMKDISYFGTMMVHNGD 120 +LG+++ A +++P+ R EEF E + E+RK K + D AR+ M D +YFGTMMVH G Sbjct: 431 KLGINIEGATVIDPVESNRYEEFVETYFEIRKHKGIVRDVARDRMSDPTYFGTMMVHKGL 490 Query: 121 ADGMVSGAANTTAHTIKPSFQIIKTVPEASVVSSIFLMVLRGRLWAFGDCAVNPNPTAEQ 180 ADGMVSG+ TTA TI+P+F+ +KT P SVVSSIF+M + R+ AFGDCAV PNP A Q Sbjct: 491 ADGMVSGSVTTTAQTIRPAFEFVKTKPHVSVVSSIFIMCFQSRVLAFGDCAVVPNPDARQ 550 Query: 181 LGEIAVVSAKTAAQFGIDPRVAILSYSTGNSGGGSDVDRAIDALAEARRLNPELCVD--- 237 L EIA+ SA+TA F I+PRVA+LSYSTG SG G DV++ ++A A AR+L E +D Sbjct: 551 LAEIALSSAETARIFNIEPRVAMLSYSTGISGSGQDVEKVVEATAIARQLMEERGLDFPL 610 Query: 238 -GPLQFDAAVDPGVARKKMPDSDVAGQANVFIFPDLEAGNIGYKTAQRTGHALAVGPILQ 296 GPLQ+DAA D VA+ K P+S VAG+A VF+FPDL GN YK QR +A+A+GP+LQ Sbjct: 611 EGPLQYDAAFDLEVAKVKSPESVVAGRATVFVFPDLNTGNNTYKAVQRAANAVAMGPVLQ 670 Query: 297 GLNKPVNDLSRGATVPDIVNTVAITAIQA 325 GLNKPVNDLSRG TV DIV+TVA+TA+QA Sbjct: 671 GLNKPVNDLSRGCTVLDIVDTVALTALQA 699 Lambda K H 0.318 0.134 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 521 Number of extensions: 22 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 329 Length of database: 706 Length adjustment: 34 Effective length of query: 295 Effective length of database: 672 Effective search space: 198240 Effective search space used: 198240 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
Align candidate WP_028585908.1 G494_RS0119815 (phosphate acetyltransferase)
to HMM TIGR00651 (pta: phosphate acetyltransferase (EC 2.3.1.8))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00651.hmm # target sequence database: /tmp/gapView.18361.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00651 [M=304] Accession: TIGR00651 Description: pta: phosphate acetyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.2e-122 393.3 0.1 5.9e-122 392.8 0.1 1.2 1 lcl|NCBI__GCF_000429965.1:WP_028585908.1 G494_RS0119815 phosphate acetylt Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000429965.1:WP_028585908.1 G494_RS0119815 phosphate acetyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 392.8 0.1 5.9e-122 5.9e-122 1 304 [] 391 696 .. 391 696 .. 0.97 Alignments for each domain: == domain 1 score: 392.8 bits; conditional E-value: 5.9e-122 TIGR00651 1 ivlPEgseervlkAaallaekkiaekvllvnkeeevknkakevnlklgkvvvedpdvskdiekyverly 69 ivlPEg +r+l+Aa ++++++ia+ +ll++k+e+ + ka+++ ++++ +v+dp s+ e++ve+++ lcl|NCBI__GCF_000429965.1:WP_028585908.1 391 IVLPEGLGQRMLQAADIILRRGIADLTLLGRKDEIAT-KAAKLGINIEGATVIDPVESNRYEEFVETYF 458 8****************************99888877.9****************************** PP TIGR00651 70 ekrkhkGvtekeareqlrDevslaallvelgeadglvsGavsttaktlrpalqiiktlegvklvssvfi 138 e rkhkG+ + ar+ + D++++++++v++g adg+vsG+v tta+t+rpa++ +kt++ v++vss+fi lcl|NCBI__GCF_000429965.1:WP_028585908.1 459 EIRKHKGIVRDVARDRMSDPTYFGTMMVHKGLADGMVSGSVTTTAQTIRPAFEFVKTKPHVSVVSSIFI 527 ********************************************************************* PP TIGR00651 139 mekeeevlvfaDCavavdPnaeeLAeiAlqsaksakslgeeepkvallsystkgsgkgeevekvkeAvk 207 m+ +++vl f+DCav+++P+a++LAeiAl+sa++a+ ++ +ep+va+lsyst+ sg+g++vekv+eA++ lcl|NCBI__GCF_000429965.1:WP_028585908.1 528 MCFQSRVLAFGDCAVVPNPDARQLAEIALSSAETARIFN-IEPRVAMLSYSTGISGSGQDVEKVVEATA 595 **************************************9.****************************8 PP TIGR00651 208 ilk....ekepdllldGelqfDaAlvekvaekkapesevagkanvfvFPdLdaGnigYkivqRladaea 272 i++ e+ d+ l+G+lq+DaA+ +va+ k pes vag+a+vfvFPdL++Gn++Yk+vqR a+a a lcl|NCBI__GCF_000429965.1:WP_028585908.1 596 IARqlmeERGLDFPLEGPLQYDAAFDLEVAKVKSPESVVAGRATVFVFPDLNTGNNTYKAVQRAANAVA 664 86533338999********************************************************** PP TIGR00651 273 iGPilqGlakPvnDLsRGasvedivnvviita 304 +GP+lqGl+kPvnDLsRG++v div +v++ta lcl|NCBI__GCF_000429965.1:WP_028585908.1 665 MGPVLQGLNKPVNDLSRGCTVLDIVDTVALTA 696 *****************************996 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (304 nodes) Target sequences: 1 (706 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 19.24 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory