Align Ornithine aminotransferase; OAT; EC 2.6.1.13; Ornithine--oxo-acid aminotransferase (uncharacterized)
to candidate WP_028740449.1 RL_RS02885 aspartate aminotransferase family protein
Query= curated2:C3P3K3 (396 letters) >NCBI__GCF_000009265.1:WP_028740449.1 Length = 399 Score = 259 bits (662), Expect = 9e-74 Identities = 140/383 (36%), Positives = 218/383 (56%), Gaps = 14/383 (3%) Query: 17 NNYHPLPIVISKAEGVWVEDPEGNRYMDLLSAYSAVNQGHRHPKIINALIDQANRVTLTS 76 + Y P+ + EGVW+ G RY+D + + + GH +P ++ AL +QA++V S Sbjct: 9 DTYSRAPLRFERGEGVWLITESGERYLDFGAGVAVTSVGHSNPHVVGALKEQADKVWHLS 68 Query: 77 RAFHSDQLGPWYEKVAK----LTNKEMVLPMNTGAEAVETAIKTARRWAYDVKKVEANRA 132 + P E++AK T + V N+GAEA+E AIKTARR Y K R Sbjct: 69 NIYEI----PGQERLAKRLTDATFADKVFFTNSGAEALECAIKTARR--YQFSKGHPERF 122 Query: 133 EIIVCEDNFHGRTMGAVSMSSNEEYKRGFGPMLPGIIVIPYGDLEALKAAITPNTAAFIL 192 II E FHGRT+ ++ E+Y GFGP PG + +GD+EA++AAIT TAA ++ Sbjct: 123 HIITFEGAFHGRTLATIAAGGQEKYLEGFGPKAPGFDQVAFGDIEAVRAAITEATAAILI 182 Query: 193 EPIQGEAGINIPPAGFLKEALEVCKKENVLFVADEIQTGLGRTGKVFACDWDNVTPDMYI 252 EP+QGE G+ F+K ++C +L + DE+QTG+GRTGK+FA +W +TPD+ Sbjct: 183 EPVQGEGGVRPATPEFMKALRQLCDDNGLLLILDEVQTGVGRTGKLFAHEWSGITPDIMA 242 Query: 253 LGKALGGGVFPISCAAANRDILGVFEPGSHGSTFGGNPLACAVSIAALEVLEEEKLTERS 312 + K +GGG FP+ A + + G+HGST+GGNPLA AV A L+++ + ++ Sbjct: 243 VAKGIGGG-FPLGACLATAEAASGMKAGTHGSTYGGNPLAMAVGSAVLDIILADGFLQQV 301 Query: 313 LQLG---EKLVGQLKEIDNPMITEVRGKGLFIGIELNEPARPYCEQLKAAGLLCKETHEN 369 + + + LK+ +I ++RG+GL +GI+ P+ + ++AA LL +N Sbjct: 302 RDVALVFRQGLASLKDRYPDVIEDIRGEGLLLGIKAAVPSAELLQAIRAAHLLGVPAGDN 361 Query: 370 VIRIAPPLVISEEDLEWAFQKIK 392 VIR+ PPLV++ E+ +I+ Sbjct: 362 VIRLLPPLVVTAEEAREGLVRIE 384 Lambda K H 0.317 0.136 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 422 Number of extensions: 26 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 396 Length of database: 399 Length adjustment: 31 Effective length of query: 365 Effective length of database: 368 Effective search space: 134320 Effective search space used: 134320 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory