Align 4-hydroxy-2-oxohexanoate aldolase (EC 4.1.3.43) (characterized)
to candidate WP_028949923.1 Q385_RS0101285 2-isopropylmalate synthase
Query= BRENDA::Q53WI0 (347 letters) >NCBI__GCF_000619805.1:WP_028949923.1 Length = 516 Score = 82.0 bits (201), Expect = 3e-20 Identities = 77/254 (30%), Positives = 116/254 (45%), Gaps = 41/254 (16%) Query: 12 VVVDTTLRDGSHAHRHQYTVEEARAIAQALDEAGVYAIEVSHGDGLGGSSLQYGFSRTDE 71 ++ DTTLRDG A TVEE +A L++ GV IE GF+ E Sbjct: 5 IIFDTTLRDGEQAPGFSMTVEEKVKMALQLEKLGVDVIEA-------------GFAAASE 51 Query: 72 --MELIRAVRETVRRAKVAALLLPGIGTRKELKEAVEA--GIQMVRIATQCTEADISEQH 127 E ++ V E ++ AKV +L + ++ +A EA + RI T + I Q+ Sbjct: 52 GDFEAVKRVAEEIKNAKVCSLAR---ALQSDIDKAGEALTPAENRRIHTFIATSPIHMQY 108 Query: 128 F-----GMAKEMGLEAVGFLMMSHMRPPEFLAEQA---------RLMEGY---GADVVYI 170 E + AV + + + EF AE A R+ E GA + + Sbjct: 109 KLKMSPDEVVERAIAAVKYAL-KYTDDVEFSAEDAFRSEREFLYRVFEAVIKAGAKTINV 167 Query: 171 VDSAGAMLPED---AYARVKALKEALSRAKVGFHAHNNLGLAIGNTLAALAAGADWVDAT 227 D+ G +PE+ A +K + +A + H HN+LGLA+ N+L+A+ GA V AT Sbjct: 168 PDTVGYAIPEEFGQLIADIKNNVPNIDKAVISVHCHNDLGLAVANSLSAVKNGARQVHAT 227 Query: 228 LRGYGAGAGNAPLE 241 + G G AGNA +E Sbjct: 228 VNGIGERAGNAAVE 241 Lambda K H 0.319 0.135 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 362 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 347 Length of database: 516 Length adjustment: 32 Effective length of query: 315 Effective length of database: 484 Effective search space: 152460 Effective search space used: 152460 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory