Align Aspartate aminotransferase; AAT; AspAT; Putative 2-aminoadipate transaminase; Transaminase A; EC 2.6.1.1; EC 2.6.1.39 (characterized)
to candidate WP_028950331.1 Q385_RS0103460 pyridoxal phosphate-dependent aminotransferase
Query= SwissProt::P58350 (410 letters) >NCBI__GCF_000619805.1:WP_028950331.1 Length = 391 Score = 311 bits (798), Expect = 2e-89 Identities = 167/395 (42%), Positives = 240/395 (60%), Gaps = 8/395 (2%) Query: 15 ASRISSIGVSEILKIGARAAAMKREGKPVIILGAGEPDFDTPEHVKQAASDAIHRGETKY 74 ++RI I S+ L I A+A +K +G +I GAGEPDFDTP+ VK+AA A+ G+TKY Sbjct: 4 SNRIKKIKPSQTLAITAKANELKAKGVDIISFGAGEPDFDTPDFVKEAAIKALKEGKTKY 63 Query: 75 TALDGTPELKKAIREKFQRENGLAYELDEITVATGAKQILFNAMMASLDPGDEVIIPTPY 134 TA G P+L++AI +K + N + Y E+ V GAK L+ L+PGDEVI+P PY Sbjct: 64 TAAAGIPQLREAIAQKLKNRNNIDYSPSEVIVVPGAKMGLYEIFAILLNPGDEVIVPAPY 123 Query: 135 WTSYSDIVHICEGKPVLIACDASSGFRLTAEKLEAAITPRTRWVLLNSPSNPSGAAYSAA 194 W SY++ + + +G+ V+ +GF LTA+ +E++ITP+T+ ++LNSPSNP+GA Sbjct: 124 WVSYTEQIALNDGESVIPQLSEENGFILTADIVESSITPKTKALVLNSPSNPTGAVIPKK 183 Query: 195 DYRPLLEVLLRHPHVWLLVDDMYEHIVYDGFRFVTPAQLEPGLKNRTLTVNGVSKAYAMT 254 + + EV L+H ++ ++ D+ YE Y G V+ A L ++ T TV SK+Y+MT Sbjct: 184 ELEKIAEVCLKH-NIMIISDECYEEFSY-GEPHVSIASLSREVREITFTVGAFSKSYSMT 241 Query: 255 GWRIGYAGGPRELIKAMAVVQSQATSCPSSISQAASVAALNGPQDFLKERTESFQRRRDL 314 GWR+G+ P + IKAM +QSQ S P++ +Q ++ AL F F +RRD Sbjct: 242 GWRLGWVAAPEKYIKAMTNIQSQTISNPTTFAQYGALEALKDNGQFPAMMRNEFVKRRDY 301 Query: 315 VVNGLNAIDGLDCRVPEGAFYTFSGCAGVLGKVTPSGKRIKTDTDFCAYLLEDAHVAVVP 374 +V LN+I G+ C PEGAFY F + + IK D D AYLLE+ VAVVP Sbjct: 302 IVEALNSIKGVRCIKPEGAFYAFPNVSYYI------KGNIKNDVDLSAYLLEEGKVAVVP 355 Query: 375 GSAFGLSPFFRISYATSEAELKEALERIAAACDRL 409 GSAFG + R+SYATS +KE +ERI A ++L Sbjct: 356 GSAFGKEGYIRLSYATSMENIKEGVERIKQALEKL 390 Lambda K H 0.318 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 423 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 410 Length of database: 391 Length adjustment: 31 Effective length of query: 379 Effective length of database: 360 Effective search space: 136440 Effective search space used: 136440 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory