Protein WP_028950337.1 in Sulfurihydrogenibium subterraneum DSM 15120

GapMind for catabolism of small carbon sources

Protein WP_028950337.1 in Sulfurihydrogenibium subterraneum DSM 15120

Annotation: NCBI__GCF_000619805.1:WP_028950337.1

Length: 225 amino acids

Source: GCF_000619805.1 in NCBI

Candidate for 57 steps in catabolism of small carbon sources

Pathway	Step	Score	Similar to	Id.	Cov.	Bits	Other hit	Other id.	Other bits
L-arginine catabolism	artP	med	Arginine transport ATP-binding protein ArtM (characterized)	42%	89%	151	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	214.9
D-cellobiose catabolism	glcV	lo	monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized)	37%	63%	152.9	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	214.9
D-galactose catabolism	glcV	lo	monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized)	37%	63%	152.9	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	214.9
D-glucose catabolism	glcV	lo	monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized)	37%	63%	152.9	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	214.9
lactose catabolism	glcV	lo	monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized)	37%	63%	152.9	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	214.9
D-maltose catabolism	glcV	lo	monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized)	37%	63%	152.9	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	214.9
D-mannose catabolism	glcV	lo	monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized)	37%	63%	152.9	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	214.9
sucrose catabolism	glcV	lo	monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized)	37%	63%	152.9	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	214.9
trehalose catabolism	glcV	lo	monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized)	37%	63%	152.9	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	214.9
L-histidine catabolism	PA5503	lo	Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized)	35%	66%	146.7	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	214.9
L-asparagine catabolism	bgtA	lo	ATPase (characterized, see rationale)	35%	84%	140.6	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	214.9
L-aspartate catabolism	bgtA	lo	ATPase (characterized, see rationale)	35%	84%	140.6	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	214.9
D-maltose catabolism	malK1	lo	MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized)	36%	59%	139.8	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	214.9
trehalose catabolism	thuK	lo	MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized)	36%	59%	139.8	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	214.9
L-asparagine catabolism	aatP	lo	Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized)	36%	89%	137.1	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	214.9
L-asparagine catabolism	peb1C	lo	PEB1C, component of Uptake system for glutamate and aspartate (characterized)	34%	89%	137.1	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	214.9
L-aspartate catabolism	aatP	lo	Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized)	36%	89%	137.1	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	214.9
L-aspartate catabolism	peb1C	lo	PEB1C, component of Uptake system for glutamate and aspartate (characterized)	34%	89%	137.1	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	214.9
L-glutamate catabolism	gltL	lo	PEB1C, component of Uptake system for glutamate and aspartate (characterized)	34%	89%	137.1	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	214.9
L-histidine catabolism	hisP	lo	Histidine transport ATP-binding protein HisP (characterized)	37%	82%	136	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	214.9
L-lysine catabolism	hisP	lo	Histidine transport ATP-binding protein HisP (characterized)	37%	82%	136	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	214.9
L-histidine catabolism	Ac3H11_2560	lo	ABC transporter for L-Histidine, ATPase component (characterized)	37%	78%	135.2	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	214.9
putrescine catabolism	potA	lo	Spermidine/putrescine import ATP-binding protein PotA, component of The spermidine/putrescine uptake porter, PotABCD (characterized)	34%	57%	134.8	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	214.9
L-arabinose catabolism	araV	lo	AraV, component of Arabinose, fructose, xylose porter (characterized)	32%	59%	133.7	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	214.9
D-fructose catabolism	araV	lo	AraV, component of Arabinose, fructose, xylose porter (characterized)	32%	59%	133.7	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	214.9
sucrose catabolism	araV	lo	AraV, component of Arabinose, fructose, xylose porter (characterized)	32%	59%	133.7	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	214.9
D-xylose catabolism	araV	lo	AraV, component of Arabinose, fructose, xylose porter (characterized)	32%	59%	133.7	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	214.9
L-fucose catabolism	SM_b21106	lo	ABC transporter for L-Fucose, ATPase component (characterized)	37%	59%	132.5	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	214.9
D-maltose catabolism	malK_Bb	lo	ABC-type maltose transport, ATP binding protein (characterized, see rationale)	33%	62%	132.1	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	214.9
D-cellobiose catabolism	gtsD	lo	GtsD (GLcK), component of Glucose porter, GtsABCD (characterized)	32%	56%	128.3	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	214.9
D-glucose catabolism	gtsD	lo	GtsD (GLcK), component of Glucose porter, GtsABCD (characterized)	32%	56%	128.3	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	214.9
lactose catabolism	gtsD	lo	GtsD (GLcK), component of Glucose porter, GtsABCD (characterized)	32%	56%	128.3	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	214.9
D-maltose catabolism	gtsD	lo	GtsD (GLcK), component of Glucose porter, GtsABCD (characterized)	32%	56%	128.3	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	214.9
sucrose catabolism	gtsD	lo	GtsD (GLcK), component of Glucose porter, GtsABCD (characterized)	32%	56%	128.3	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	214.9
trehalose catabolism	gtsD	lo	GtsD (GLcK), component of Glucose porter, GtsABCD (characterized)	32%	56%	128.3	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	214.9
D-galactose catabolism	PfGW456L13_1897	lo	ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized)	32%	55%	127.9	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	214.9
D-sorbitol (glucitol) catabolism	mtlK	lo	ABC transporter for D-Sorbitol, ATPase component (characterized)	33%	58%	127.9	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	214.9
D-xylose catabolism	gtsD	lo	ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized)	32%	55%	127.5	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	214.9
D-maltose catabolism	thuK	lo	Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized)	32%	59%	126.3	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	214.9
trehalose catabolism	treV	lo	TreV, component of Trehalose porter (characterized)	37%	59%	126.3	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	214.9
D-glucosamine (chitosamine) catabolism	SM_b21216	lo	ABC transporter for D-Glucosamine, ATPase component (characterized)	33%	60%	125.9	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	214.9
D-maltose catabolism	malK	lo	ABC-type maltose transporter (subunit 3/3) (EC 7.5.2.1) (characterized)	32%	58%	125.6	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	214.9
xylitol catabolism	Dshi_0546	lo	ABC transporter for Xylitol, ATPase component (characterized)	33%	64%	124.4	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	214.9
lactose catabolism	lacK	lo	ABC transporter for Lactose, ATPase component (characterized)	33%	60%	122.9	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	214.9
D-mannitol catabolism	mtlK	lo	SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter (characterized)	32%	65%	120.9	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	214.9
N-acetyl-D-glucosamine catabolism	SMc02869	lo	N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized)	33%	61%	120.6	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	214.9
D-glucosamine (chitosamine) catabolism	SMc02869	lo	N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized)	33%	61%	120.6	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	214.9
D-maltose catabolism	malK_Aa	lo	ABC-type maltose transporter (EC 7.5.2.1) (characterized)	30%	56%	118.6	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	214.9
D-cellobiose catabolism	aglK'	lo	Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale)	32%	58%	109.4	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	214.9
D-glucose catabolism	aglK'	lo	Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale)	32%	58%	109.4	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	214.9
lactose catabolism	aglK'	lo	Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale)	32%	58%	109.4	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	214.9
D-maltose catabolism	aglK	lo	ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized)	32%	60%	109.4	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	214.9
D-maltose catabolism	aglK'	lo	Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale)	32%	58%	109.4	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	214.9
sucrose catabolism	aglK	lo	ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized)	32%	60%	109.4	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	214.9
sucrose catabolism	aglK'	lo	Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale)	32%	58%	109.4	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	214.9
trehalose catabolism	aglK	lo	ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized)	32%	60%	109.4	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	214.9
trehalose catabolism	aglK'	lo	Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale)	32%	58%	109.4	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	214.9

Sequence Analysis Tools

View WP_028950337.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MSSVLLENVKKVYKNAQEEVWALKGISLKVENGQMIAVMGPSGSGKSTLLHIIGGIDYPT
EGKVLINGLQINNLNDKQLSKFRNENIGFVFQFHYLLPEFTALENVMIPMEIKGEKNVKE
KAIEILTKFNLQHRLNHKPPQLSGGEQQRVAIARAVANQPSLLIADEPTGNLDSQNAKNV
IMLFKELNEKKGMTIIIATHDIEIAKYCKYIYYMKDGMLVNIEKV

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Downloads

Candidates (tab-delimited)
Steps (tab-delimited)
Rules (tab-delimited)
Protein sequences (fasta format)
Organisms (tab-delimited)
SQLite3 databases

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
HMMer finds a hit (regardless of coverage or other bits).

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

our ignorance of proteins' functions,
omissions in the gene models,
frame-shift errors in the genome sequence, or
the organism lacks the pathway.

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

the paper from 2019 on GapMind for amino acid biosynthesis
the paper from 2022 on GapMind for carbon sources
the source code
instructions for running GapMind on your computer

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory

GapMind for catabolism of small carbon sources