Align 4-hydroxy-2-oxovalerate aldolase; HOA; EC 4.1.3.39; 4-hydroxy-2-keto-pentanoic acid aldolase; 4-hydroxy-2-oxopentanoate aldolase (uncharacterized)
to candidate WP_028950471.1 Q385_RS0104225 citramalate synthase
Query= curated2:Q0PHX9 (341 letters) >NCBI__GCF_000619805.1:WP_028950471.1 Length = 533 Score = 67.4 bits (163), Expect = 8e-16 Identities = 61/194 (31%), Positives = 99/194 (51%), Gaps = 19/194 (9%) Query: 154 EEAKKLEAYGAEAVIIMDSSGTYLPLDVTRRVSALKES-IGIGVGFHAHNNLGMAIANSI 212 E K + GA+ +I+ D++G LP D+ R ++KE+ I +G HAHN+ A+ NSI Sbjct: 161 EVLKVAQQAGADFLILCDTNGGSLPTDIERAFKSVKEAGITAKLGIHAHNDSDTAVWNSI 220 Query: 213 AAIEAGAVLIDGSIRGFGAGAGNAQLETLVAVLE-RLGVAT--GIDLYRVLDAGDFAETL 269 A+ GAV + G+I G G GNA L +++ L +LG T ++ R+ + +F + Sbjct: 221 VAVLNGAVQVHGTINGIGERCGNANLCSIIPNLSLKLGYETVPRENIKRLKEISNFVSDI 280 Query: 270 FVKELPVVRSLSIVSGLSGVFSG--FSKPVLR-IASENGVDPRDVFFELGRRRAV----- 321 +PV +++ V + G + VLR S + P E+G RR V Sbjct: 281 I--NMPVPKNMPYVGDSAFAHKGGVHASAVLRNPRSYEHILPE----EVGNRRKVLVSDL 334 Query: 322 AGQEDLILEVVKEI 335 AG+ ++I + KEI Sbjct: 335 AGKSNIIYK-AKEI 347 Lambda K H 0.320 0.135 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 352 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 341 Length of database: 533 Length adjustment: 32 Effective length of query: 309 Effective length of database: 501 Effective search space: 154809 Effective search space used: 154809 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory