GapMind for catabolism of small carbon sources

 

Protein WP_028950678.1 in Sulfurihydrogenibium subterraneum DSM 15120

Annotation: NCBI__GCF_000619805.1:WP_028950678.1

Length: 228 amino acids

Source: GCF_000619805.1 in NCBI

Candidate for 50 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-arginine catabolism artP med Arginine transport ATP-binding protein ArtM (characterized) 42% 90% 170.2 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 46% 202.2
L-asparagine catabolism peb1C med PEB1C, component of Uptake system for glutamate and aspartate (characterized) 43% 90% 161 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 46% 202.2
L-aspartate catabolism peb1C med PEB1C, component of Uptake system for glutamate and aspartate (characterized) 43% 90% 161 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 46% 202.2
L-glutamate catabolism gltL med PEB1C, component of Uptake system for glutamate and aspartate (characterized) 43% 90% 161 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 46% 202.2
L-asparagine catabolism aatP med Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized) 41% 90% 159.8 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 46% 202.2
L-aspartate catabolism aatP med Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized) 41% 90% 159.8 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 46% 202.2
L-histidine catabolism hisP med Histidine transport ATP-binding protein HisP (characterized) 40% 88% 154.5 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 46% 202.2
L-lysine catabolism hisP med Histidine transport ATP-binding protein HisP (characterized) 40% 88% 154.5 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 46% 202.2
L-tryptophan catabolism ecfA2 med Energy-coupling factor transporter ATP-binding protein EcfA2; Short=ECF transporter A component EcfA2; EC 7.-.-.- (characterized, see rationale) 41% 73% 139.8 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 46% 202.2
L-asparagine catabolism glnQ lo Glutamine ABC transporter ATP-binding protein, component of Glutamine transporter, GlnQP. Takes up glutamine, asparagine and glutamate which compete for each other for binding both substrate and the transmembrane protein constituent of the system (Fulyani et al. 2015). Tandem substrate binding domains (SBDs) differ in substrate specificity and affinity, allowing cells to efficiently accumulate different amino acids via a single ABC transporter. Analysis revealed the roles of individual residues in determining the substrate affinity (characterized) 38% 87% 151.8 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 46% 202.2
L-asparagine catabolism bgtA lo ATPase (characterized, see rationale) 40% 84% 150.2 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 46% 202.2
L-aspartate catabolism bgtA lo ATPase (characterized, see rationale) 40% 84% 150.2 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 46% 202.2
L-citrulline catabolism AO353_03040 lo ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized) 37% 90% 149.1 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 46% 202.2
L-asparagine catabolism bztD lo BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 39% 82% 148.7 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 46% 202.2
L-aspartate catabolism bztD lo BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 39% 82% 148.7 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 46% 202.2
L-histidine catabolism BPHYT_RS24015 lo ABC transporter related (characterized, see rationale) 37% 85% 148.3 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 46% 202.2
L-asparagine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 37% 84% 144.4 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 46% 202.2
L-aspartate catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 37% 84% 144.4 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 46% 202.2
L-glutamate catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 37% 84% 144.4 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 46% 202.2
L-histidine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 37% 84% 144.4 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 46% 202.2
L-leucine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 37% 84% 144.4 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 46% 202.2
L-proline catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 37% 84% 144.4 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 46% 202.2
D-alanine catabolism Pf6N2E2_5405 lo ABC transporter for D-Alanine, ATPase component (characterized) 37% 85% 141.4 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 46% 202.2
L-citrulline catabolism PS417_17605 lo ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale) 33% 82% 137.5 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 46% 202.2
D-glucosamine (chitosamine) catabolism AO353_21725 lo ABC transporter for D-glucosamine, ATPase component (characterized) 34% 86% 137.1 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 46% 202.2
D-mannose catabolism TM1749 lo TM1749, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized) 37% 75% 128.6 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 46% 202.2
sucrose catabolism thuK lo ABC transporter (characterized, see rationale) 34% 56% 128.6 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 46% 202.2
D-sorbitol (glucitol) catabolism mtlK lo ABC transporter for D-Sorbitol, ATPase component (characterized) 33% 61% 127.9 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 46% 202.2
L-histidine catabolism Ac3H11_2560 lo ABC transporter for L-Histidine, ATPase component (characterized) 34% 86% 127.1 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 46% 202.2
L-histidine catabolism hutV lo ABC transporter for L-Histidine, ATPase component (characterized) 35% 79% 126.3 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 46% 202.2
D-cellobiose catabolism SMc04256 lo ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized) 33% 60% 124.4 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 46% 202.2
lactose catabolism lacK lo LacK, component of Lactose porter (characterized) 34% 59% 124.4 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 46% 202.2
putrescine catabolism potA lo spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 (characterized) 33% 56% 124 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 46% 202.2
D-maltose catabolism malK lo ABC-type maltose transporter (subunit 3/3) (EC 7.5.2.1) (characterized) 33% 58% 121.7 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 46% 202.2
D-maltose catabolism thuK lo ThuK aka RB0314 aka SMB20328, component of Trehalose/maltose/sucrose porter (trehalose inducible) (characterized) 34% 63% 121.7 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 46% 202.2
trehalose catabolism thuK lo ThuK aka RB0314 aka SMB20328, component of Trehalose/maltose/sucrose porter (trehalose inducible) (characterized) 34% 63% 121.7 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 46% 202.2
L-arabinose catabolism xacJ lo Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale) 30% 56% 117.5 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 46% 202.2
N-acetyl-D-glucosamine catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 34% 60% 115.5 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 46% 202.2
D-glucosamine (chitosamine) catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 34% 60% 115.5 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 46% 202.2
D-mannitol catabolism mtlK lo ABC transporter for D-mannitol and D-mannose, ATPase component (characterized) 32% 59% 114.4 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 46% 202.2
D-cellobiose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 33% 58% 109.4 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 46% 202.2
D-glucose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 33% 58% 109.4 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 46% 202.2
lactose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 33% 58% 109.4 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 46% 202.2
D-maltose catabolism aglK lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 33% 58% 109.4 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 46% 202.2
D-maltose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 33% 58% 109.4 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 46% 202.2
sucrose catabolism aglK lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 33% 58% 109.4 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 46% 202.2
sucrose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 33% 58% 109.4 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 46% 202.2
trehalose catabolism aglK lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 33% 58% 109.4 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 46% 202.2
trehalose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 33% 58% 109.4 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 46% 202.2
glycerol catabolism glpS lo ABC transporter for Glycerol, ATPase component 1 (characterized) 31% 52% 90.9 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 46% 202.2

Sequence Analysis Tools

View WP_028950678.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MEILSVKNIEKVIGQEKILKNINLSVNKGEFLSIIGPSGSGKSTLLYILGLLDSPTKGEV
IVENQVISFKDKNKLATLRNKKFGFVFQFHYLINELTLEENVMVPMLKAKVNKNVAREKA
NILLEKLGLKGKENRKPYQISGGEQQRVSIARALSNDPDILIADEPTGNLDSKNTEKVME
IFKQINQEGKTIVMVTHEIDLAEKTDRIVKMKDGQIVEEILLKSDIIK

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory