Align phosphomannose mutase (EC 5.4.2.8) (characterized)
to candidate WP_028950733.1 Q385_RS0105635 phosphoglucomutase
Query= metacyc::MONOMER-13382 (455 letters) >NCBI__GCF_000619805.1:WP_028950733.1 Length = 456 Score = 216 bits (551), Expect = 9e-61 Identities = 160/459 (34%), Positives = 229/459 (49%), Gaps = 19/459 (4%) Query: 5 FGTFGVRGIANEKITPEFAMKIGMAFGTLLKREGRKKPLVVVGRDTRVSGEMLKEALISG 64 FGT G R I + T + KI A LK G KK VV+G DTR E ++ Sbjct: 4 FGTDGYRAIIGQDYTFDIVEKIAQAQADSLKERGGKK--VVIGYDTRFMSEDFALSVAEV 61 Query: 65 LLSVGCDV-IDVGIAPTPAVQWATKHFNADGGAVITASHNPPEYNGIKLLEPNGMGLKKE 123 S G +V + G TPA+ +A K AD G +ITASHN +YNG K+ G + Sbjct: 62 FSSNGFEVFVSKGNCTTPALSYAVKSLEADEGVMITASHNGYKYNGYKIKGSYGGPATVD 121 Query: 124 REAIVEELFFKEDFDRAKWYEIGEVRREDIIKPYIEAIKSKVDVEAIKKRKPFVVVDTSN 183 VE F K K + + D+ Y++ IKS D K+++ V+ D Sbjct: 122 IIKDVESRFGKSAVLNGK----KDFQFLDLTSHYLQKIKSYFDYSIFKQKELKVIHDPMF 177 Query: 184 GAGSLTLPYLLRELGCKVITVNAQPDGYFPARNPEPNEENLKEFMEIVKALGADFGVAQD 243 LL + VI +N D YF +PEP ++NL V AL +D G+A D Sbjct: 178 ATSIGLYNRLLEDTFIDVIQINHFKDPYFGGHHPEPIDKNLSLLKAKVIALESDLGIAND 237 Query: 244 GDADRAVFIDENGRFIQGDKTFALVA-DAVLKEKGGGLLVTTVATSNLLDDIAKKHGAKV 302 GD+DR + E G F+ +AL+ V K G +V TV+T+ L D IA+K G K+ Sbjct: 238 GDSDRVGIVSETGEFVSTQILYALLLLHTVRNRKFKGSIVKTVSTTYLADRIAQKEGLKI 297 Query: 303 MRTKVGDLIVARALYENNGTIGGEENGGVIFPEHVLGRDGAMTVAKVVEIFAKSGKKFSE 362 +T VG VA + + GGEE+GG F H+ RDG ++ ++E+ GK +E Sbjct: 298 HKTPVGFKYVADIMLKETVAFGGEESGGYGFGFHIPERDGVLSGMLMLEMLMLYGKPLNE 357 Query: 363 LIDELPKYY-QIKTKRH---VEGDRHAIVNK------VAEMARERGYTVDTTDGAKIIFE 412 +I +L K + + KR VEG + + K V E A R DTTDG K+IFE Sbjct: 358 IIKDLFKEFGEAHYKREDLKVEGSQGLDLVKSFKEKDVKEFAGLRVKEKDTTDGVKLIFE 417 Query: 413 -DGWVLVRASGTEPIIRIFSEAKSKEKAQEYLNLGIELL 450 D W+L+RASGTEP++RI++E S + ++ +N +L+ Sbjct: 418 DDSWLLLRASGTEPVLRIYAETPSLKTTEKLINEAKKLI 456 Lambda K H 0.317 0.138 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 544 Number of extensions: 33 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 455 Length of database: 456 Length adjustment: 33 Effective length of query: 422 Effective length of database: 423 Effective search space: 178506 Effective search space used: 178506 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory