Align UDP-glucose 4-epimerase; Galactowaldenase; UDP-galactose 4-epimerase; EC 5.1.3.2 (characterized)
to candidate WP_028988640.1 G579_RS0100585 UDP-N-acetylglucosamine 4,6-dehydratase (inverting)
Query= SwissProt::Q9ZDJ5 (341 letters) >NCBI__GCF_000423825.1:WP_028988640.1 Length = 332 Score = 206 bits (524), Expect = 7e-58 Identities = 118/286 (41%), Positives = 176/286 (61%), Gaps = 9/286 (3%) Query: 1 MFVDKTLMITGGTGSFGNAVLSRFLKSNIINDIKEIRIFSRDEKKQEDM-RIALNNSKLK 59 M +K++++TGGTGSFG+ + L + + + I+SRDE KQ +M ++ + +++ Sbjct: 1 MLTNKSILVTGGTGSFGHTFVPMTLAKY---NPRRLVIYSRDEMKQWEMAKLYGKDERVR 57 Query: 60 FYIGDVRNYQSIDDAMHGVDYVFHAAALKQVPTCEFYPMEAINTNVLGAENVLSAAINNK 119 F+IGDVR+ + A+HG+DYV HAAA K VPT E+ P E + TN+ GA N++ A I+ Sbjct: 58 FFIGDVRDKDRLARALHGIDYVVHAAATKIVPTAEYNPFECVKTNINGAMNLIDACIDQG 117 Query: 120 VTKVIVLSTDKAVYPINAMGLSKALMEKLAIAKARMRSPGETILCVTRYGNVMASRGSVI 179 V +V+ LSTDKA P N G +K +KL +A +T V RYGNVM SRGSVI Sbjct: 118 VKRVVALSTDKASSPANLYGATKLASDKLFVAGNSYAGSEDTRFAVVRYGNVMGSRGSVI 177 Query: 180 PLFIHQIKQGKELTITEPSMTRFLMSLVDSVDLVLYAFEHGRQGDIFVQKSPASTIEVLA 239 P F+ QG EL IT+ MTRF+++L +V LV +AFE G+I+V+K P+ + +A Sbjct: 178 PFFLSIADQG-ELPITDERMTRFMITLEQAVKLVWHAFEDMIGGEIYVKKIPSMKVTDIA 236 Query: 240 KALQEIFGSKNAIRFIGTRHGEKHYESLVSSEDMAKADDLGGYYRI 285 +A+ ++ AI IG R GEK +E ++ +ED + YY+I Sbjct: 237 RAVAP--DARQAI--IGIRPGEKLHEQMIGAEDAPHTYEYADYYKI 278 Lambda K H 0.319 0.135 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 279 Number of extensions: 18 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 341 Length of database: 332 Length adjustment: 28 Effective length of query: 313 Effective length of database: 304 Effective search space: 95152 Effective search space used: 95152 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory