Protein WP_028989885.1 in Thermithiobacillus tepidarius DSM 3134
Annotation: NCBI__GCF_000423825.1:WP_028989885.1
Length: 227 amino acids
Source: GCF_000423825.1 in NCBI
Candidate for 34 steps in catabolism of small carbon sources
Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
L-arginine catabolism | artP | med | BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized) | 41% | 83% | 144.1 | ABC transporter ATP-binding protein YtrE | 45% | 189.1 |
L-glutamate catabolism | gltL | med | GluA aka CGL1950, component of Glutamate porter (characterized) | 41% | 83% | 144.1 | ABC transporter ATP-binding protein YtrE | 45% | 189.1 |
L-histidine catabolism | bgtA | med | BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized) | 41% | 83% | 144.1 | ABC transporter ATP-binding protein YtrE | 45% | 189.1 |
L-lysine catabolism | hisP | med | BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized) | 41% | 83% | 144.1 | ABC transporter ATP-binding protein YtrE | 45% | 189.1 |
D-cellobiose catabolism | gtsD | lo | Sugar ABC transporter ATP-binding protein (characterized, see rationale) | 39% | 56% | 144.8 | ABC transporter ATP-binding protein YtrE | 45% | 189.1 |
D-glucose catabolism | gtsD | lo | Sugar ABC transporter ATP-binding protein (characterized, see rationale) | 39% | 56% | 144.8 | ABC transporter ATP-binding protein YtrE | 45% | 189.1 |
lactose catabolism | gtsD | lo | Sugar ABC transporter ATP-binding protein (characterized, see rationale) | 39% | 56% | 144.8 | ABC transporter ATP-binding protein YtrE | 45% | 189.1 |
D-maltose catabolism | gtsD | lo | Sugar ABC transporter ATP-binding protein (characterized, see rationale) | 39% | 56% | 144.8 | ABC transporter ATP-binding protein YtrE | 45% | 189.1 |
sucrose catabolism | gtsD | lo | Sugar ABC transporter ATP-binding protein (characterized, see rationale) | 39% | 56% | 144.8 | ABC transporter ATP-binding protein YtrE | 45% | 189.1 |
trehalose catabolism | gtsD | lo | Sugar ABC transporter ATP-binding protein (characterized, see rationale) | 39% | 56% | 144.8 | ABC transporter ATP-binding protein YtrE | 45% | 189.1 |
putrescine catabolism | potA | lo | spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 (characterized) | 40% | 54% | 141.7 | ABC transporter ATP-binding protein YtrE | 45% | 189.1 |
D-maltose catabolism | malK | lo | Maltose-transporting ATPase (EC 3.6.3.19) (characterized) | 37% | 59% | 139.8 | ABC transporter ATP-binding protein YtrE | 45% | 189.1 |
L-asparagine catabolism | bztD | lo | BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) | 39% | 80% | 138.7 | ABC transporter ATP-binding protein YtrE | 45% | 189.1 |
L-aspartate catabolism | bztD | lo | BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) | 39% | 80% | 138.7 | ABC transporter ATP-binding protein YtrE | 45% | 189.1 |
L-citrulline catabolism | AO353_03040 | lo | ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized) | 39% | 82% | 137.1 | ABC transporter ATP-binding protein YtrE | 45% | 189.1 |
sucrose catabolism | thuK | lo | ABC transporter (characterized, see rationale) | 39% | 54% | 137.1 | ABC transporter ATP-binding protein YtrE | 45% | 189.1 |
D-glucosamine (chitosamine) catabolism | AO353_21725 | lo | ABC transporter for D-glucosamine, ATPase component (characterized) | 38% | 87% | 136.7 | ABC transporter ATP-binding protein YtrE | 45% | 189.1 |
N-acetyl-D-glucosamine catabolism | SMc02869 | lo | N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) | 39% | 62% | 135.6 | ABC transporter ATP-binding protein YtrE | 45% | 189.1 |
D-glucosamine (chitosamine) catabolism | SMc02869 | lo | N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) | 39% | 62% | 135.6 | ABC transporter ATP-binding protein YtrE | 45% | 189.1 |
D-maltose catabolism | thuK | lo | Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) | 37% | 52% | 134.4 | ABC transporter ATP-binding protein YtrE | 45% | 189.1 |
trehalose catabolism | thuK | lo | Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) | 37% | 52% | 134.4 | ABC transporter ATP-binding protein YtrE | 45% | 189.1 |
L-histidine catabolism | Ac3H11_2560 | lo | ABC transporter for L-Histidine, ATPase component (characterized) | 38% | 78% | 133.7 | ABC transporter ATP-binding protein YtrE | 45% | 189.1 |
L-citrulline catabolism | PS417_17605 | lo | ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale) | 39% | 76% | 133.3 | ABC transporter ATP-binding protein YtrE | 45% | 189.1 |
D-alanine catabolism | Pf6N2E2_5405 | lo | ABC transporter for D-Alanine, ATPase component (characterized) | 38% | 81% | 132.5 | ABC transporter ATP-binding protein YtrE | 45% | 189.1 |
D-sorbitol (glucitol) catabolism | mtlK | lo | ABC transporter for D-Sorbitol, ATPase component (characterized) | 38% | 54% | 132.5 | ABC transporter ATP-binding protein YtrE | 45% | 189.1 |
D-glucosamine (chitosamine) catabolism | SM_b21216 | lo | ABC transporter for D-Glucosamine, ATPase component (characterized) | 36% | 60% | 130.2 | ABC transporter ATP-binding protein YtrE | 45% | 189.1 |
xylitol catabolism | Dshi_0546 | lo | ABC transporter for Xylitol, ATPase component (characterized) | 37% | 61% | 130.2 | ABC transporter ATP-binding protein YtrE | 45% | 189.1 |
D-mannitol catabolism | mtlK | lo | SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter (characterized) | 39% | 58% | 127.5 | ABC transporter ATP-binding protein YtrE | 45% | 189.1 |
D-maltose catabolism | malK_Bb | lo | ABC-type maltose transport, ATP binding protein (characterized, see rationale) | 34% | 58% | 126.3 | ABC transporter ATP-binding protein YtrE | 45% | 189.1 |
D-cellobiose catabolism | msiK | lo | MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) | 34% | 57% | 125.9 | ABC transporter ATP-binding protein YtrE | 45% | 189.1 |
D-maltose catabolism | malK_Aa | lo | ABC-type maltose transporter (EC 7.5.2.1) (characterized) | 35% | 56% | 125.9 | ABC transporter ATP-binding protein YtrE | 45% | 189.1 |
L-arabinose catabolism | xacK | lo | Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) | 35% | 55% | 124 | ABC transporter ATP-binding protein YtrE | 45% | 189.1 |
lactose catabolism | lacK | lo | LacK, component of Lactose porter (characterized) | 36% | 53% | 124 | ABC transporter ATP-binding protein YtrE | 45% | 189.1 |
D-maltose catabolism | malK1 | lo | MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) | 34% | 54% | 115.9 | ABC transporter ATP-binding protein YtrE | 45% | 189.1 |
Sequence Analysis Tools
Find papers: PaperBLAST
Find functional residues: SitesBLAST
Search for conserved domains
Find the best match in UniProt
Compare to protein structures
Predict transmenbrane helices: Phobius
Predict protein localization: PSORTb
Find homologs in fast.genomics
Fitness BLAST: loading...
Sequence
MLSIHQLCKAYGGPQGRPVLRDVDLTLAAGDYVAIMGESGTGKSTLLNLIAGLDTPDAGR
ILLAGRELTGMGEAERTRLRRRSMGFVFQAFHLLPHLTVAQNVALPLALNQVPASRRRAR
VQALLAAVGLAARADSYPRELSGGQMQRVAVARALVHEPQLLLADEPTGNLDQDSAAQVL
ELLRRQVREHGCTAILVTHSRSAAASADRVYRLDAEGLHLQAPARTP
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Links
Downloads
Related tools
About GapMind
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using
ublast (a fast alternative to protein BLAST)
against a database of manually-curated proteins (most of which are experimentally characterized) or by using
HMMer with enzyme models (usually from
TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
- ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
- HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.
where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").
Otherwise, a candidate is "medium confidence" if either:
- ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
- ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
- HMMer finds a hit (regardless of coverage or other bits).
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps."
For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways.
For diverse bacteria and archaea that can utilize a carbon source, there is a complete
high-confidence catabolic pathway (including a transporter) just 38% of the time, and
there is a complete medium-confidence pathway 63% of the time.
Gaps may be due to:
- our ignorance of proteins' functions,
- omissions in the gene models,
- frame-shift errors in the genome sequence, or
- the organism lacks the pathway.
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory