GapMind for catabolism of small carbon sources

 

Protein WP_028989885.1 in Thermithiobacillus tepidarius DSM 3134

Annotation: NCBI__GCF_000423825.1:WP_028989885.1

Length: 227 amino acids

Source: GCF_000423825.1 in NCBI

Candidate for 34 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-arginine catabolism artP med BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized) 41% 83% 144.1 ABC transporter ATP-binding protein YtrE 45% 189.1
L-glutamate catabolism gltL med GluA aka CGL1950, component of Glutamate porter (characterized) 41% 83% 144.1 ABC transporter ATP-binding protein YtrE 45% 189.1
L-histidine catabolism bgtA med BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized) 41% 83% 144.1 ABC transporter ATP-binding protein YtrE 45% 189.1
L-lysine catabolism hisP med BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized) 41% 83% 144.1 ABC transporter ATP-binding protein YtrE 45% 189.1
D-cellobiose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 39% 56% 144.8 ABC transporter ATP-binding protein YtrE 45% 189.1
D-glucose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 39% 56% 144.8 ABC transporter ATP-binding protein YtrE 45% 189.1
lactose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 39% 56% 144.8 ABC transporter ATP-binding protein YtrE 45% 189.1
D-maltose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 39% 56% 144.8 ABC transporter ATP-binding protein YtrE 45% 189.1
sucrose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 39% 56% 144.8 ABC transporter ATP-binding protein YtrE 45% 189.1
trehalose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 39% 56% 144.8 ABC transporter ATP-binding protein YtrE 45% 189.1
putrescine catabolism potA lo spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 (characterized) 40% 54% 141.7 ABC transporter ATP-binding protein YtrE 45% 189.1
D-maltose catabolism malK lo Maltose-transporting ATPase (EC 3.6.3.19) (characterized) 37% 59% 139.8 ABC transporter ATP-binding protein YtrE 45% 189.1
L-asparagine catabolism bztD lo BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 39% 80% 138.7 ABC transporter ATP-binding protein YtrE 45% 189.1
L-aspartate catabolism bztD lo BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 39% 80% 138.7 ABC transporter ATP-binding protein YtrE 45% 189.1
L-citrulline catabolism AO353_03040 lo ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized) 39% 82% 137.1 ABC transporter ATP-binding protein YtrE 45% 189.1
sucrose catabolism thuK lo ABC transporter (characterized, see rationale) 39% 54% 137.1 ABC transporter ATP-binding protein YtrE 45% 189.1
D-glucosamine (chitosamine) catabolism AO353_21725 lo ABC transporter for D-glucosamine, ATPase component (characterized) 38% 87% 136.7 ABC transporter ATP-binding protein YtrE 45% 189.1
N-acetyl-D-glucosamine catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 39% 62% 135.6 ABC transporter ATP-binding protein YtrE 45% 189.1
D-glucosamine (chitosamine) catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 39% 62% 135.6 ABC transporter ATP-binding protein YtrE 45% 189.1
D-maltose catabolism thuK lo Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 37% 52% 134.4 ABC transporter ATP-binding protein YtrE 45% 189.1
trehalose catabolism thuK lo Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 37% 52% 134.4 ABC transporter ATP-binding protein YtrE 45% 189.1
L-histidine catabolism Ac3H11_2560 lo ABC transporter for L-Histidine, ATPase component (characterized) 38% 78% 133.7 ABC transporter ATP-binding protein YtrE 45% 189.1
L-citrulline catabolism PS417_17605 lo ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale) 39% 76% 133.3 ABC transporter ATP-binding protein YtrE 45% 189.1
D-alanine catabolism Pf6N2E2_5405 lo ABC transporter for D-Alanine, ATPase component (characterized) 38% 81% 132.5 ABC transporter ATP-binding protein YtrE 45% 189.1
D-sorbitol (glucitol) catabolism mtlK lo ABC transporter for D-Sorbitol, ATPase component (characterized) 38% 54% 132.5 ABC transporter ATP-binding protein YtrE 45% 189.1
D-glucosamine (chitosamine) catabolism SM_b21216 lo ABC transporter for D-Glucosamine, ATPase component (characterized) 36% 60% 130.2 ABC transporter ATP-binding protein YtrE 45% 189.1
xylitol catabolism Dshi_0546 lo ABC transporter for Xylitol, ATPase component (characterized) 37% 61% 130.2 ABC transporter ATP-binding protein YtrE 45% 189.1
D-mannitol catabolism mtlK lo SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter (characterized) 39% 58% 127.5 ABC transporter ATP-binding protein YtrE 45% 189.1
D-maltose catabolism malK_Bb lo ABC-type maltose transport, ATP binding protein (characterized, see rationale) 34% 58% 126.3 ABC transporter ATP-binding protein YtrE 45% 189.1
D-cellobiose catabolism msiK lo MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) 34% 57% 125.9 ABC transporter ATP-binding protein YtrE 45% 189.1
D-maltose catabolism malK_Aa lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 35% 56% 125.9 ABC transporter ATP-binding protein YtrE 45% 189.1
L-arabinose catabolism xacK lo Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) 35% 55% 124 ABC transporter ATP-binding protein YtrE 45% 189.1
lactose catabolism lacK lo LacK, component of Lactose porter (characterized) 36% 53% 124 ABC transporter ATP-binding protein YtrE 45% 189.1
D-maltose catabolism malK1 lo MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 34% 54% 115.9 ABC transporter ATP-binding protein YtrE 45% 189.1

Sequence Analysis Tools

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MLSIHQLCKAYGGPQGRPVLRDVDLTLAAGDYVAIMGESGTGKSTLLNLIAGLDTPDAGR
ILLAGRELTGMGEAERTRLRRRSMGFVFQAFHLLPHLTVAQNVALPLALNQVPASRRRAR
VQALLAAVGLAARADSYPRELSGGQMQRVAVARALVHEPQLLLADEPTGNLDQDSAAQVL
ELLRRQVREHGCTAILVTHSRSAAASADRVYRLDAEGLHLQAPARTP

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory