Align UDP-glucose 4-epimerase; EC 5.1.3.2; Galactowaldenase; UDP-galactose 4-epimerase (uncharacterized)
to candidate WP_028990328.1 G579_RS0111685 UDP-glucose 4-epimerase GalE
Query= curated2:Q9KDV3 (334 letters) >NCBI__GCF_000423825.1:WP_028990328.1 Length = 325 Score = 350 bits (897), Expect = e-101 Identities = 170/316 (53%), Positives = 213/316 (67%) Query: 3 ILVTGGAGYIGSHTVLFLLEQGEQVIVLDNLQKGHAGALSDVTFYHGDIRDDQLLDTIFT 62 ILV GGAGYIGSH V LL+ G QV LDN G+ A+ GD+ D +LLD +F Sbjct: 4 ILVVGGAGYIGSHMVKMLLQAGHQVTTLDNFSAGYQDAVLGGELVAGDLADRELLDHLFR 63 Query: 63 THSIDTVIHFAANSLVGESVKQPIEYYENNVIGTHTLLKKMLEHDVKKIVFSSTAATYGE 122 D V+HFA+ VGESV P +YY NN T LL M++H V+ +FSSTAA +GE Sbjct: 64 DRRFDGVMHFASYIQVGESVLDPGKYYRNNFTNTLNLLDAMVQHGVRAFIFSSTAAIFGE 123 Query: 123 PVQIPIQESDPTIPTNPYGETKLAIEKMFHWCQEAYGLQYVCLRYFNAAGADPNGRIGED 182 P IPI E P P NPYG +K +E+ AYGL+ V LRYFNAAGADP+G++GE Sbjct: 124 PRYIPIDEQHPKAPINPYGRSKWMVEQALADYDHAYGLKSVALRYFNAAGADPDGQLGER 183 Query: 183 HSPESHLIPIVLQVALGQRERVAIFGDDYQTEDGSCIRDYIHVMDLANAHYLACEHLRKD 242 H PE+HLIP+VLQ A G+R + ++G DY T DG+CIRDYIHV+DL AH LA E L Sbjct: 184 HDPETHLIPLVLQAASGRRPHITVYGRDYDTPDGTCIRDYIHVLDLCQAHLLALEQLWAG 243 Query: 243 GQSGSFNLGNGKGFSVKEVIEVCRQVTGHPIPAEIAPRRSGDPASLIASSEKAQTILGWE 302 G+S ++NLGNG+GFSV+EVI+ R+VTG IP RR+GDPA L+A S +AQ ILGW+ Sbjct: 244 GESAAYNLGNGQGFSVQEVIDTARRVTGREIPVLDGERRAGDPARLVADSRRAQEILGWQ 303 Query: 303 PKYPSLETMVEHAWNW 318 P+Y L T++EHAW W Sbjct: 304 PRYADLATIIEHAWRW 319 Lambda K H 0.317 0.135 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 411 Number of extensions: 14 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 334 Length of database: 325 Length adjustment: 28 Effective length of query: 306 Effective length of database: 297 Effective search space: 90882 Effective search space used: 90882 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate WP_028990328.1 G579_RS0111685 (UDP-glucose 4-epimerase GalE)
to HMM TIGR01179 (galE: UDP-glucose 4-epimerase GalE (EC 5.1.3.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01179.hmm # target sequence database: /tmp/gapView.9934.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01179 [M=332] Accession: TIGR01179 Description: galE: UDP-glucose 4-epimerase GalE Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.6e-139 448.5 0.0 6.3e-139 448.4 0.0 1.0 1 lcl|NCBI__GCF_000423825.1:WP_028990328.1 G579_RS0111685 UDP-glucose 4-epi Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000423825.1:WP_028990328.1 G579_RS0111685 UDP-glucose 4-epimerase GalE # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 448.4 0.0 6.3e-139 6.3e-139 2 328 .. 4 323 .. 3 325 .] 0.99 Alignments for each domain: == domain 1 score: 448.4 bits; conditional E-value: 6.3e-139 TIGR01179 2 iLvtGgaGyiGshvvrqllekgkevvvlDnlskgskealkalekitevklvegdladkekleavleeek 70 iLv+GgaGyiGsh+v+ ll++g++v +lDn s g ++a+ +e lv gdlad+e l++++++++ lcl|NCBI__GCF_000423825.1:WP_028990328.1 4 ILVVGGAGYIGSHMVKMLLQAGHQVTTLDNFSAGYQDAVLGGE------LVAGDLADRELLDHLFRDRR 66 9******************************************......******************** PP TIGR01179 71 idaviHfaaliavgEsvkePlkYYennvvntleLleamqkagvkkliFsssaavYgesekvpisEespl 139 +d v+Hfa++i+vgEsv +P kYY+nn +ntl+Ll+am+++gv+ +iFss+aa++ge++ +pi E++p lcl|NCBI__GCF_000423825.1:WP_028990328.1 67 FDGVMHFASYIQVGESVLDPGKYYRNNFTNTLNLLDAMVQHGVRAFIFSSTAAIFGEPRYIPIDEQHPK 135 ********************************************************************* PP TIGR01179 140 npinpYGrsklmvErilkdlkkadkelkvviLRYFnvaGAdeegeiGeasknathliklvaevavgkre 208 +pinpYGrsk mvE+ l d+ +a ++lk v+LRYFn+aGAd++g++Ge++ ++thli+lv+++a+g+r+ lcl|NCBI__GCF_000423825.1:WP_028990328.1 136 APINPYGRSKWMVEQALADYDHA-YGLKSVALRYFNAAGADPDGQLGERHDPETHLIPLVLQAASGRRP 203 **********************9.********************************************* PP TIGR01179 209 kleifGtdyptkDGtcvRDyiHveDlaeaHlaalealeeggesevynlGagqgfsvkevieavkkvsgk 277 +++++G dy+t+DGtc+RDyiHv Dl +aHl ale+l++gges++ynlG+gqgfsv+evi+++++v+g+ lcl|NCBI__GCF_000423825.1:WP_028990328.1 204 HITVYGRDYDTPDGTCIRDYIHVLDLCQAHLLALEQLWAGGESAAYNLGNGQGFSVQEVIDTARRVTGR 272 ********************************************************************* PP TIGR01179 278 dikveladrRaGDpaslvadaskikrelgwkpkyddLeeiiksawdWekkl 328 +i+v +rRaGDpa+lvad+ ++++ lgw+p+y dL++ii+ aw+We++l lcl|NCBI__GCF_000423825.1:WP_028990328.1 273 EIPVLDGERRAGDPARLVADSRRAQEILGWQPRYADLATIIEHAWRWETRL 323 ************************************************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (332 nodes) Target sequences: 1 (325 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.01 # Mc/sec: 10.14 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory