GapMind for catabolism of small carbon sources

 

Protein WP_028990350.1 in Thermithiobacillus tepidarius DSM 3134

Annotation: NCBI__GCF_000423825.1:WP_028990350.1

Length: 238 amino acids

Source: GCF_000423825.1 in NCBI

Candidate for 34 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-asparagine catabolism bgtA med ATPase (characterized, see rationale) 44% 84% 156.4 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 41% 178.7
L-aspartate catabolism bgtA med ATPase (characterized, see rationale) 44% 84% 156.4 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 41% 178.7
L-glutamate catabolism gltL med GluA aka CGL1950, component of Glutamate porter (characterized) 45% 84% 148.3 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 41% 178.7
L-arginine catabolism artP med Arginine transport ATP-binding protein ArtM (characterized) 40% 87% 137.9 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 41% 178.7
L-histidine catabolism BPHYT_RS24015 med ABC transporter related (characterized, see rationale) 40% 80% 133.7 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 41% 178.7
L-asparagine catabolism peb1C lo PEB1C, component of Uptake system for glutamate and aspartate (characterized) 39% 84% 138.7 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 41% 178.7
L-aspartate catabolism peb1C lo PEB1C, component of Uptake system for glutamate and aspartate (characterized) 39% 84% 138.7 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 41% 178.7
L-asparagine catabolism glnQ lo Glutamine ABC transporter ATP-binding protein, component of Glutamine transporter, GlnQP. Takes up glutamine, asparagine and glutamate which compete for each other for binding both substrate and the transmembrane protein constituent of the system (Fulyani et al. 2015). Tandem substrate binding domains (SBDs) differ in substrate specificity and affinity, allowing cells to efficiently accumulate different amino acids via a single ABC transporter. Analysis revealed the roles of individual residues in determining the substrate affinity (characterized) 39% 88% 136.7 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 41% 178.7
lactose catabolism lacK lo ABC transporter for Lactose, ATPase component (characterized) 38% 58% 131 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 41% 178.7
D-cellobiose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 36% 55% 129 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 41% 178.7
D-glucose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 36% 55% 129 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 41% 178.7
lactose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 36% 55% 129 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 41% 178.7
D-maltose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 36% 55% 129 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 41% 178.7
sucrose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 36% 55% 129 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 41% 178.7
trehalose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 36% 55% 129 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 41% 178.7
D-xylose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 36% 55% 129 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 41% 178.7
L-arabinose catabolism xacK lo Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) 38% 56% 128.6 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 41% 178.7
D-glucosamine (chitosamine) catabolism SM_b21216 lo ABC transporter for D-Glucosamine, ATPase component (characterized) 38% 57% 128.3 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 41% 178.7
D-mannitol catabolism mtlK lo ABC transporter for D-mannitol and D-mannose, ATPase component (characterized) 36% 59% 128.3 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 41% 178.7
D-sorbitol (glucitol) catabolism mtlK lo ABC transporter for D-Sorbitol, ATPase component (characterized) 38% 54% 127.9 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 41% 178.7
L-arabinose catabolism xacJ lo Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale) 37% 55% 127.5 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 41% 178.7
D-galactose catabolism PfGW456L13_1897 lo ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 35% 55% 125.9 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 41% 178.7
D-maltose catabolism malK lo ABC-type maltose transporter (subunit 3/3) (EC 7.5.2.1) (characterized) 37% 56% 125.2 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 41% 178.7
D-cellobiose catabolism msiK lo MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) 37% 53% 122.1 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 41% 178.7
D-maltose catabolism musK lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 37% 53% 122.1 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 41% 178.7
D-maltose catabolism malK1 lo MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 34% 58% 121.7 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 41% 178.7
trehalose catabolism thuK lo MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 34% 58% 121.7 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 41% 178.7
D-maltose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 36% 59% 120.9 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 41% 178.7
D-maltose catabolism thuK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 36% 59% 120.9 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 41% 178.7
sucrose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 36% 59% 120.9 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 41% 178.7
trehalose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 36% 59% 120.9 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 41% 178.7
D-cellobiose catabolism SMc04256 lo ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized) 35% 55% 112.1 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 41% 178.7
D-maltose catabolism malK_Sm lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 32% 57% 110.2 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 41% 178.7
trehalose catabolism malK lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 32% 57% 110.2 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 41% 178.7

Sequence Analysis Tools

View WP_028990350.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MPQEPQPVFIAHGLTKTYRTGEVEVHALRGVDLEIYESEFVVLLGPSGSGKSTLLNILGG
LDTPTSGEAFWRDHDLSRADEGELTRYRREHVGFVFQFYNLISSLTVRENVALVTEISPQ
PMAPEEALQLVGLAQRLDHFPSQLSGGEQQRVAIARAIAKRPDVLLCDEPTGALDYETGK
VVLEVIARINQELGTTAVVITHNAAIAGMADRVLHLADGRITTIETNTRKLTPAELSW

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory