Align trans-2,3-dehydroadipyl-CoA hydratase (EC 4.2.1.17) (characterized)
to candidate WP_028996383.1 H537_RS0100790 enoyl-CoA hydratase
Query= reanno::BFirm:BPHYT_RS17335 (258 letters) >NCBI__GCF_000430725.1:WP_028996383.1 Length = 264 Score = 366 bits (940), Expect = e-106 Identities = 181/264 (68%), Positives = 215/264 (81%), Gaps = 6/264 (2%) Query: 1 MAYENILVETRG------RVGLVTLNRPKALNALNDALMDELGAALREFDADDAIGAIVV 54 M ++N++ G + ++TL+RPKALNALND LMDELG AL FDADD++G IV+ Sbjct: 1 MEFQNLMTALHGGEDGTLKTAVITLHRPKALNALNDPLMDELGQALLAFDADDSVGCIVL 60 Query: 55 TGSEKAFAAGADIGMMSTYTYMDVYKGDYITRNWETVRSIRKPIIAAVAGFALGGGCELA 114 TGSE+AFAAGADI M+ +MDV+K +ITRNWET+R +RKP+IAAV GFALGGGCELA Sbjct: 61 TGSERAFAAGADIAAMAKREFMDVFKTQFITRNWETIRKVRKPVIAAVGGFALGGGCELA 120 Query: 115 MMCDIIFAADTAKFGQPEIKLGIMPGAGGTQRLPRAVSKAKAMDLCLTARFMDAAEAERA 174 MMCD I AADTAKFGQPEIK+GIMPGAGGTQRLPRA+ K+KAMDL LT R MDA EAERA Sbjct: 121 MMCDFIIAADTAKFGQPEIKIGIMPGAGGTQRLPRAIGKSKAMDLILTGRMMDAQEAERA 180 Query: 175 GLVSRVIPAASLVDEAIAAAATIAEFPSPAVMMVKESVNRAYETTLAEGVHFERRLFHSL 234 GLVSRV+PA L++EA+AAAA I F P+V+M K+ VNRAYETTL+EG+ +ER LFHS+ Sbjct: 181 GLVSRVVPADKLLEEALAAAAVICSFGLPSVIMAKDCVNRAYETTLSEGIAYERGLFHSM 240 Query: 235 FATEDQKEGMAAFVEKRKPVFKHR 258 FATEDQKEGM AF+ KRK FKHR Sbjct: 241 FATEDQKEGMDAFLSKRKANFKHR 264 Lambda K H 0.321 0.134 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 247 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 264 Length adjustment: 25 Effective length of query: 233 Effective length of database: 239 Effective search space: 55687 Effective search space used: 55687 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory