Align 4-hydroxyphenylpyruvate dioxygenase; 4HPPD; HPD; HPPDase; EC 1.13.11.27 (uncharacterized)
to candidate WP_028999745.1 H537_RS0123135 sugar phosphate isomerase/epimerase and 4-hydroxyphenylpyruvate domain-containing protein
Query= curated2:Q9I576 (357 letters) >NCBI__GCF_000430725.1:WP_028999745.1 Length = 637 Score = 146 bits (368), Expect = 2e-39 Identities = 102/341 (29%), Positives = 160/341 (46%), Gaps = 12/341 (3%) Query: 17 GFEFVEFTAPDAKGIEQLRQLFNMMGFTETAKHRSKEVFLFQQNDINIVLNGSPTGHVHE 76 G F+EF A D E L L +GF +HRSK V LF+Q +N+VLN T E Sbjct: 301 GLSFIEF-AVDGAHAEALGHLVRQLGFRFAGRHRSKAVTLFRQGGVNLVLNQQATPAARE 359 Query: 77 FALKHGPSACAMAFRVKNASQAAAYAESQGAKLVGSHANFGELNIPSLEGIGGSLLYLVD 136 GPS CA+ R + A A + + + GE +PS+ GG +L+ VD Sbjct: 360 RFSLQGPSVCALGLRTDDPVGALNRATALQSARYDAPTGTGEQRLPSIVAPGGIVLHFVD 419 Query: 137 R-YGDRSIYDVDFEFIEGRSANDNSVGLTYIDHLTHNVKRGQMDVWSGFYERIANF---R 192 G+ +++ DF + GL IDHL + ++D W F + Sbjct: 420 EALGENGLFEKDFILEPEAAEGAGGAGLECIDHLAVGLTADRLDTWVLFCRAVLGLDAGD 479 Query: 193 EIRYFDIEGKLTGLFSRAMTAPCGKIRIPINESADDTSQIEEFIREYHGEGIQHIALTTD 252 +++ D G + S M+ +R+ +N S + +++ + + G G+QHIA Sbjct: 480 AVKFADPFGLIR---STGMSDAARHLRLVLNMSMSERTRMAQAAQASGGVGVQHIAFGCS 536 Query: 253 DIYATVRKLRDNGVKFMSTPDTYYEKVDTRVAGHGEPLEQLRELNLLIDGAPGDDGILLQ 312 D++A V KLR GV+F+ D YY+ + TR E +++LR +L D +P G L Sbjct: 537 DLFAAVDKLRRAGVRFVPISDNYYDDLPTRFEVAPELVQRLRAAGVLFDRSP--QGDYLH 594 Query: 313 IFTDTVIGP-IFFEIIQRKGN-QGFGEGNFKALFESIEEDQ 351 +T+ G FFE++QR G G+G N A S +++ Sbjct: 595 AYTEGYAGAGFFFELVQRLGGYDGYGAVNAPARMASQAQEE 635 Lambda K H 0.320 0.139 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 527 Number of extensions: 25 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 357 Length of database: 637 Length adjustment: 33 Effective length of query: 324 Effective length of database: 604 Effective search space: 195696 Effective search space used: 195696 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory