Align Fumarylacetoacetase; FAA; Beta-diketonase; Fumarylacetoacetate hydrolase; EC 3.7.1.2 (characterized)
to candidate WP_028999960.1 H537_RS0124565 fumarylacetoacetase
Query= SwissProt::P16930 (419 letters) >NCBI__GCF_000430725.1:WP_028999960.1 Length = 434 Score = 391 bits (1004), Expect = e-113 Identities = 204/416 (49%), Positives = 274/416 (65%), Gaps = 18/416 (4%) Query: 9 DSDFPIHNLPYGVFSTRGDPRP-RIGVAIGDQILDLSIIKH--LFTGPVLSKHQDVFNQP 65 D+DFPI NLP+ VF +G R GVAIGDQI+DL+ + LF G + Q Sbjct: 22 DTDFPIQNLPFAVFRRKGSSEAFRGGVAIGDQIVDLAAVSAAGLFDGAA-GEAVAAAAQG 80 Query: 66 TLNSFMGLGQAAWKEARVFLQNLLSVSQARLRDDTELRKCAFISQASATMHLPATIGDYT 125 LN+ M LGQ AW+ R+ L L A+ L+ C + Q A +PA IGDYT Sbjct: 81 KLNALMALGQPAWRALRLALSRALRDGAAQ---QPRLQAC-LVPQVEAQYDVPARIGDYT 136 Query: 126 DFYSSRQHATNVGIMFRDKENALMPNWLHLPVGYHGRASSVVVSGTPIRRPMGQMKPDDS 185 DFY+S HATN+G +FR +N LMPN+ +P+GYHGR+SS+ VSG RRP+GQ P + Sbjct: 137 DFYTSVHHATNIGRLFRP-DNPLMPNYKWVPIGYHGRSSSIAVSGQVFRRPVGQTLPAGA 195 Query: 186 KPPVYGACKLLDMELEMAFFVGPGNRLGEPIPISKAHEHIFGMVLMNDWSARDIQKWEYV 245 PV G + LD+ELE+ F+G GN LGEP+ I +A +H+FG+ L+NDWSARDIQ WEY Sbjct: 196 TQPVTGPSQRLDIELELGIFIGSGNSLGEPVAIEQAEDHVFGICLLNDWSARDIQAWEYQ 255 Query: 246 PLGPFLGKSFGTTVSPWVVPMDALMPFAVP--NPKQDPRPLPYL---CHDEPYTFDINLS 300 PLGPF+ K+F TT+SPW+V +DAL P+ VP P+ DP+PLPYL + + DI L Sbjct: 256 PLGPFMSKNFATTISPWIVTLDALAPYRVPFQRPEGDPQPLPYLDSEANRREGSLDIQLQ 315 Query: 301 VNLKGEGMSQA---ATICKSNFKYMYWTMLQQLTHHSVNGCNLRPGDLLASGTISGPEPE 357 V+L + +A ATIC++++++ YWT+ Q + HH+VNGCNL+PGDL SGT+SGP + Sbjct: 316 VDLLTPRLREAGSVATICRTSYRHAYWTVAQMVAHHTVNGCNLQPGDLFGSGTLSGPTLD 375 Query: 358 NFGSMLELSWKGTKPIDLGNGQTRKFLLDGDEVIITGYCQGDG-YRIGFGQCAGKV 412 G+++EL+ G +P+ L +G+TR FL DGD VII G+C+ G RIGFGQC G V Sbjct: 376 QAGALIELTSGGKQPLQLPDGETRTFLQDGDSVIIRGWCKKPGAARIGFGQCMGTV 431 Lambda K H 0.321 0.139 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 610 Number of extensions: 38 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 419 Length of database: 434 Length adjustment: 32 Effective length of query: 387 Effective length of database: 402 Effective search space: 155574 Effective search space used: 155574 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
Align candidate WP_028999960.1 H537_RS0124565 (fumarylacetoacetase)
to HMM TIGR01266 (fahA: fumarylacetoacetase (EC 3.7.1.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01266.hmm # target sequence database: /tmp/gapView.20458.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01266 [M=420] Accession: TIGR01266 Description: fum_ac_acetase: fumarylacetoacetase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.4e-176 571.5 0.0 6.1e-176 571.3 0.0 1.0 1 lcl|NCBI__GCF_000430725.1:WP_028999960.1 H537_RS0124565 fumarylacetoaceta Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000430725.1:WP_028999960.1 H537_RS0124565 fumarylacetoacetase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 571.3 0.0 6.1e-176 6.1e-176 1 418 [. 13 433 .. 13 434 .] 0.94 Alignments for each domain: == domain 1 score: 571.3 bits; conditional E-value: 6.1e-176 TIGR01266 1 sfvavak..nsdfplqnlPyGvfstkadssr.rigvaiGdqildlskiaaaglfeglalkehqevfkes 66 s+v++a+ ++dfp+qnlP+ vf k +s+ r gvaiGdqi+dl+++ aaglf+g a++e+ + ++ lcl|NCBI__GCF_000430725.1:WP_028999960.1 13 SWVDSANypDTDFPIQNLPFAVFRRKGSSEAfRGGVAIGDQIVDLAAVSAAGLFDG-AAGEAVAAAAQG 80 89***99999*************966554433789*********************.9999******** PP TIGR01266 67 tlnaflalgrparkevrerlqkllsesaevlrdnaalrke...allaqaeatmhlPaqiGdytdfyssi 132 lna++alg+pa++++r l + lrd aa++++ l++q ea+ +Pa+iGdytdfy+s+ lcl|NCBI__GCF_000430725.1:WP_028999960.1 81 KLNALMALGQPAWRALRLALSRA-------LRDGAAQQPRlqaCLVPQVEAQYDVPARIGDYTDFYTSV 142 *****************887655.......566666655422169************************ PP TIGR01266 133 rhatnvGilfrgkdnallPnykhlPvgyhGrassvvvsGtelrrPvGqikadnakePvfgpckkldlel 201 +hatn+G lfr +dn+l+Pnyk++P+gyhGr+ss+ vsG rrPvGq+++++a +Pv gp+++ld+el lcl|NCBI__GCF_000430725.1:WP_028999960.1 143 HHATNIGRLFR-PDNPLMPNYKWVPIGYHGRSSSIAVSGQVFRRPVGQTLPAGATQPVTGPSQRLDIEL 210 ***********.********************************************************* PP TIGR01266 202 elaffvgtenelGeavpiekaeehifGvvllndwsardiqaweyvPlGPflaksfattvsPwvvsieal 270 el++f+g++n+lGe+v ie+ae+h+fG++llndwsardiqawey+PlGPf++k+fatt+sPw+v+++al lcl|NCBI__GCF_000430725.1:WP_028999960.1 211 ELGIFIGSGNSLGEPVAIEQAEDHVFGICLLNDWSARDIQAWEYQPLGPFMSKNFATTISPWIVTLDAL 279 ********************************************************************* PP TIGR01266 271 ePfrvaqlePeqdpkplpylredr..adtafdielevslkteGlae...aavisrsnakslywtlkqql 334 P+rv+ +Pe+dp+plpyl + + ++di+l+v+l t l+e a+i+r+ ++ ywt++q++ lcl|NCBI__GCF_000430725.1:WP_028999960.1 280 APYRVPFQRPEGDPQPLPYLDSEAnrREGSLDIQLQVDLLTPRLREagsVATICRTSYRHAYWTVAQMV 348 ********************876434899**********9998888655789***************** PP TIGR01266 335 ahhsvnGcnlraGdllgsGtisGkeeeafGsllelsakGkkevkladgetrkfledGdevilrgvckke 403 ahh+vnGcnl++Gdl+gsGt+sG+ ++ G+l+el+ +Gk++++l dgetr+fl+dGd vi+rg ckk lcl|NCBI__GCF_000430725.1:WP_028999960.1 349 AHHTVNGCNLQPGDLFGSGTLSGPTLDQAGALIELTSGGKQPLQLPDGETRTFLQDGDSVIIRGWCKKP 417 ********************************************************************* PP TIGR01266 404 Gvr.vGfGecaGkvlp 418 G +GfG+c G+v + lcl|NCBI__GCF_000430725.1:WP_028999960.1 418 GAArIGFGQCMGTVTA 433 *877*********976 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (420 nodes) Target sequences: 1 (434 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02 # Mc/sec: 7.67 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory