Align fumarylacetoacetase (EC 3.7.1.2) (characterized)
to candidate WP_029000842.1 H537_RS0130085 FAA hydrolase family protein
Query= BRENDA::A0A076VF18 (308 letters) >NCBI__GCF_000430725.1:WP_029000842.1 Length = 288 Score = 141 bits (356), Expect = 2e-38 Identities = 88/206 (42%), Positives = 121/206 (58%), Gaps = 13/206 (6%) Query: 83 MGLQYSGDPAN---PQDKPPVACLFFKASQALAGPGDDIVLPRLARDEKNDYEVELCVVL 139 +GL Y+ A P K PV LF KA+ AL GP D +VLP+ K D+EVEL VV+ Sbjct: 76 VGLNYADHAAESNLPVPKEPV--LFMKANTALTGPNDPVVLPQ--GSVKTDWEVELGVVI 131 Query: 140 GKDAKDVDEKDAMSFVGGYCVVNDVSSRGL-CAKGGQWGMGKSYDTWCPFGPCLVSPSAL 198 G+ A+ V E DA+ +V GYCVVNDVS R +GG W GK DT+ P GP LV+ + Sbjct: 132 GRRARYVSEDDALDYVAGYCVVNDVSEREYQLERGGTWDKGKGCDTFGPVGPWLVTRDEV 191 Query: 199 GADPHKLTITTHVNGKLAQKGNTADLVLKIPELIARLSHGTTLQAGSLILTGSPIALGRK 258 ADP L++ VNG+ Q G+T +V + EL++ +S TL+ G LI TG+P +G Sbjct: 192 -ADPQDLSMWLEVNGRRWQDGSTRTMVFGVKELVSYISRFMTLEPGDLISTGTPPGVGLG 250 Query: 259 APGDAVEQSPFMKDGDEIRCFVEGCG 284 A + V ++K GD +R ++G G Sbjct: 251 AKPNPV----YLKAGDVMRLSIQGLG 272 Lambda K H 0.316 0.135 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 264 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 288 Length adjustment: 26 Effective length of query: 282 Effective length of database: 262 Effective search space: 73884 Effective search space used: 73884 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory