Align Alr3026 protein, component of The 2-oxo monocarboxylate transporter (Pernil et al., 2010). Transports pyruvate which is inhibited by various 2-ketoacids (characterized)
to candidate WP_029132255.1 A3GO_RS0103700 C4-dicarboxylate ABC transporter substrate-binding protein
Query= TCDB::Q8YSQ8 (184 letters) >NCBI__GCF_000428045.1:WP_029132255.1 Length = 185 Score = 205 bits (522), Expect = 3e-58 Identities = 100/180 (55%), Positives = 129/180 (71%) Query: 1 MEKLLKISRIIDAFTERIGRYTSWLVLVMVILGVWNVVGRYLGRISGNNLTSNAYIEAQW 60 M+KLL+ S IIDA ERIGR SWLVL+MV+LGV+N V R L + G +L+SNAYIEAQW Sbjct: 1 MQKLLRFSGIIDAVNERIGRLISWLVLIMVLLGVYNAVTRKLSQTIGMDLSSNAYIEAQW 60 Query: 61 YIFDVIFFLGAAYTLKHNEHVRVDIFYSNWQRRRKAIADFLGTIFFLIPFSIIVIFVSWE 120 Y+F ++F GA Y LKH HVRVDI YS R KA D +GT FLIP S+++++VS+ Sbjct: 61 YMFSLVFLWGAGYALKHQAHVRVDILYSRVSERAKAWIDIIGTCLFLIPLSVLIVWVSYS 120 Query: 121 TIVASWQIGELSPDPGGLPRYPIKAMIIVGFVLLIIQGISQAIKNLAIIQGRLEPQEENH 180 SW I E+SPDPGGLPRY IK++I + FVLLI+QGIS+ IK +A ++G++ H Sbjct: 121 YAADSWAILEVSPDPGGLPRYLIKSVIPIAFVLLIVQGISELIKQIAFLKGQIPFPRSGH 180 Lambda K H 0.328 0.144 0.448 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 141 Number of extensions: 1 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 184 Length of database: 185 Length adjustment: 19 Effective length of query: 165 Effective length of database: 166 Effective search space: 27390 Effective search space used: 27390 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 44 (21.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory