Protein WP_029132351.1 in Sedimenticola selenatireducens DSM 17993

Annotation: NCBI__GCF_000428045.1:WP_029132351.1

Length: 259 amino acids

Source: GCF_000428045.1 in NCBI

Candidate for 45 steps in catabolism of small carbon sources

Pathway	Step	Score	Similar to	Id.	Cov.	Bits	Other hit	Other id.	Other bits
L-histidine catabolism	aapP	med	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component (characterized)	76%	100%	413.7	BztD, component of Glutamate/glutamine/aspartate/asparagine porter	81%	408.7
L-asparagine catabolism	aapP	med	AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized)	76%	100%	409.5	BztD, component of Glutamate/glutamine/aspartate/asparagine porter	81%	408.7
L-aspartate catabolism	aapP	med	AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized)	76%	100%	409.5	BztD, component of Glutamate/glutamine/aspartate/asparagine porter	81%	408.7
L-glutamate catabolism	aapP	med	AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized)	76%	100%	409.5	BztD, component of Glutamate/glutamine/aspartate/asparagine porter	81%	408.7
L-leucine catabolism	aapP	med	AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized)	76%	100%	409.5	BztD, component of Glutamate/glutamine/aspartate/asparagine porter	81%	408.7
L-proline catabolism	aapP	med	AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized)	76%	100%	409.5	BztD, component of Glutamate/glutamine/aspartate/asparagine porter	81%	408.7
L-asparagine catabolism	bztD	med	BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized)	81%	94%	408.7	ABC transporter for D-Alanine, ATPase component	76%	408.3
L-aspartate catabolism	bztD	med	BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized)	81%	94%	408.7	ABC transporter for D-Alanine, ATPase component	76%	408.3
L-glutamate catabolism	gltL	med	BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized)	81%	94%	408.7	ABC transporter for D-Alanine, ATPase component	76%	408.3
D-alanine catabolism	Pf6N2E2_5405	med	ABC transporter for D-Alanine, ATPase component (characterized)	76%	100%	408.3	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component	76%	413.7
L-lysine catabolism	hisP	med	Amino-acid ABC transporter, ATP-binding protein (characterized, see rationale)	63%	96%	324.3	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component	76%	413.7
L-asparagine catabolism	bgtA	med	ATPase (characterized, see rationale)	58%	100%	294.7	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component	76%	413.7
L-aspartate catabolism	bgtA	med	ATPase (characterized, see rationale)	58%	100%	294.7	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component	76%	413.7
L-asparagine catabolism	aatP	med	ABC transporter for L-Asparagine and possibly other L-amino acids, putative ATPase component (characterized)	58%	100%	294.3	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component	76%	413.7
L-aspartate catabolism	aatP	med	ABC transporter for L-Asparagine and possibly other L-amino acids, putative ATPase component (characterized)	58%	100%	294.3	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component	76%	413.7
L-asparagine catabolism	peb1C	med	PEB1C, component of Uptake system for glutamate and aspartate (characterized)	57%	100%	275	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component	76%	413.7
L-aspartate catabolism	peb1C	med	PEB1C, component of Uptake system for glutamate and aspartate (characterized)	57%	100%	275	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component	76%	413.7
L-arginine catabolism	artP	med	Arginine transport ATP-binding protein ArtM (characterized)	55%	100%	261.2	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component	76%	413.7
L-asparagine catabolism	glnQ	med	Glutamine ABC transporter ATP-binding protein, component of Glutamine transporter, GlnQP. Takes up glutamine, asparagine and glutamate which compete for each other for binding both substrate and the transmembrane protein constituent of the system (Fulyani et al. 2015). Tandem substrate binding domains (SBDs) differ in substrate specificity and affinity, allowing cells to efficiently accumulate different amino acids via a single ABC transporter. Analysis revealed the roles of individual residues in determining the substrate affinity (characterized)	53%	97%	254.2	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component	76%	413.7
L-histidine catabolism	bgtA	med	BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized)	55%	96%	252.3	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component	76%	413.7
D-glucosamine (chitosamine) catabolism	AO353_21725	med	ABC transporter for D-glucosamine, ATPase component (characterized)	49%	96%	240.7	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component	76%	413.7
L-histidine catabolism	hisP	med	Probable ATP-binding component of ABC transporter, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized)	49%	98%	235.3	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component	76%	413.7
L-citrulline catabolism	AO353_03040	med	ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized)	47%	99%	230.7	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component	76%	413.7
L-histidine catabolism	BPHYT_RS24015	med	ABC transporter related (characterized, see rationale)	48%	96%	230.7	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component	76%	413.7
L-citrulline catabolism	PS417_17605	med	ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale)	48%	92%	221.9	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component	76%	413.7
L-histidine catabolism	PA5503	med	Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized)	40%	73%	175.3	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component	76%	413.7
L-proline catabolism	proV	lo	Glycine betaine/proline betaine transport system ATP-binding protein ProV (characterized)	38%	58%	167.2	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component	76%	413.7
putrescine catabolism	potA	lo	PotG aka B0855, component of Putrescine porter (characterized)	34%	67%	157.9	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component	76%	413.7
L-proline catabolism	opuBA	lo	BusAA, component of Uptake system for glycine-betaine (high affinity) and proline (low affinity) (OpuAA-OpuABC) or BusAA-ABC of Lactococcus lactis). BusAA, the ATPase subunit, has a C-terminal tandem cystathionine β-synthase (CBS) domain which is the cytoplasmic K+ sensor for osmotic stress (osmotic strength)while the BusABC subunit has the membrane and receptor domains fused to each other (Biemans-Oldehinkel et al., 2006; Mahmood et al., 2006; Gul et al. 2012). An N-terminal amphipathic α-helix of OpuA is necessary for high activity but is not critical for biogenesis or the ionic regulation of transport (characterized)	39%	55%	154.8	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component	76%	413.7
D-cellobiose catabolism	aglK'	lo	Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale)	37%	63%	151.8	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component	76%	413.7
D-glucose catabolism	aglK'	lo	Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale)	37%	63%	151.8	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component	76%	413.7
lactose catabolism	aglK'	lo	Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale)	37%	63%	151.8	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component	76%	413.7
D-maltose catabolism	aglK	lo	Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale)	37%	63%	151.8	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component	76%	413.7
D-maltose catabolism	aglK'	lo	Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale)	37%	63%	151.8	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component	76%	413.7
sucrose catabolism	aglK	lo	Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale)	37%	63%	151.8	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component	76%	413.7
sucrose catabolism	aglK'	lo	Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale)	37%	63%	151.8	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component	76%	413.7
trehalose catabolism	aglK	lo	Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale)	37%	63%	151.8	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component	76%	413.7
trehalose catabolism	aglK'	lo	Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale)	37%	63%	151.8	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component	76%	413.7
D-maltose catabolism	malK1	lo	MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized)	37%	61%	145.2	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component	76%	413.7
trehalose catabolism	thuK	lo	MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized)	37%	61%	145.2	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component	76%	413.7
L-histidine catabolism	hutV	lo	HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized)	34%	81%	141.7	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component	76%	413.7
L-proline catabolism	hutV	lo	HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized)	34%	81%	141.7	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component	76%	413.7
D-maltose catabolism	thuK	lo	Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized)	34%	62%	140.6	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component	76%	413.7
D-mannose catabolism	TM1749	lo	TM1749, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized)	34%	80%	129.8	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component	76%	413.7
D-cellobiose catabolism	cbtF	lo	CbtF, component of Cellobiose and cellooligosaccharide porter (characterized)	33%	70%	124	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component	76%	413.7

Sequence Analysis Tools

View WP_029132351.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MSETDNAPRPSEDSADLTIEMRSVHKWYGQFHVLKDINLAVTRGERIVICGPSGSGKSTM
IRCINRLEEHQQGQIIVDGTELTDDVKHIDQVRKEVGMVFQHFNLFPHLTVLENCCLAPI
WVRKMPRREAEAVAMEYLEKVKIPEQARKYPGQLSGGQQQRVAIARSLCMNPHIMLFDEP
TSALDPEMIKEVLDTMIELAESGMTMLCVTHEMGFAKTVANRVIFMDAGEIIEENEPHEF
FNNPQSDRTKLFLSQILQH

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.