Align C4-dicarboxylate TRAP transporter large permease protein DctM (characterized)
to candidate WP_029132400.1 A3GO_RS0104560 TRAP transporter large permease
Query= SwissProt::Q9HU16 (427 letters) >NCBI__GCF_000428045.1:WP_029132400.1 Length = 433 Score = 273 bits (697), Expect = 1e-77 Identities = 158/426 (37%), Positives = 248/426 (58%), Gaps = 6/426 (1%) Query: 4 LFLFLLLFLLMFIGVPIAVSLGLSGALT-ILLFSPDSVRSLAIKL-FETSEHYTLLAIPF 61 L F ++F+L+ + VPIA+++ GA+ ++L PDSV + L FET Y+L IP Sbjct: 8 LVAFGVMFVLIGLRVPIAIAMATVGAIGGLILNGPDSVIFVMGSLPFETVFPYSLSVIPL 67 Query: 62 FLLSGAFMTTGGVARRLIDFANACVGHIRGGLAIAAVLACMLFAALSGSSPATVAAVGSI 121 F++ G F G+++ L +A +GH RGGL +A V AC F A+ GSS AT A + + Sbjct: 68 FIMMGVFAARAGLSKSLYAAVHAFIGHYRGGLGMATVGACAAFGAICGSSLATAATMSKV 127 Query: 122 AIAGMVRSGYPQAFGAGIVCNAGTLGILIPPSIVMVVYAAATETSVGKLFIAGVVPGLLL 181 A+ M + Y A + GTLG+LIPPS++MV+YA TE S+G++F A ++PG++ Sbjct: 128 AMPEMRKRNYHDGLAAASIAAGGTLGVLIPPSVIMVIYALLTEQSIGQMFAAAIIPGIVA 187 Query: 182 GLILMVVIYIVARVKKL--PAMPRVSLREWLASARKALWGLLLMVIILGGIYSGAFTPTE 239 L+ M+ ++ V PA RV +R + + LLL +++GGIY G F+PTE Sbjct: 188 TLLYMLAVWGQTLVNPAAGPADERVGMRGRIQALINVWPVLLLFSVVIGGIYMGWFSPTE 247 Query: 240 AAAVAAVYSAFVALFVYRDMRLSECPKVLLESGKLTIMLMFIIANAMLFAHVLTTEQIPQ 299 AAA+ A + AF+ + R + L E+ + M+ I+ LF + + T +P Sbjct: 248 AAAIGA-FGAFLLAALKRKLNREVFLDGLGETATTSGMIFMILIGTALFNYFVETTGLPH 306 Query: 300 SIASWVTELGLSPWMFLLVVNIVLLIAGNFMEPSAIILILAPIFFPIAMELGIDPIHLGI 359 + +V ELG +P+ LL++ I ++ G M+ +++L+ P FP+ LG DPI GI Sbjct: 307 RLVGYVGELGWAPFAILLMLIIFYILLGCVMDALSMLLLTLPFVFPLIQSLGFDPIWFGI 366 Query: 360 IMVVNMEIGLITPPVGLNLFVTSAVT-GMPLGATIRAALPWLMILLVFLIIVTYIPAVSL 418 IMV +E+GLITPPVG+NLFV A T G+ LG R +P+L+ +V + ++ PA+ L Sbjct: 367 IMVSVVEVGLITPPVGMNLFVIMATTPGLKLGTVSRGVIPFLLADVVRITLLILFPALVL 426 Query: 419 ALPNWL 424 LP+++ Sbjct: 427 WLPSFM 432 Lambda K H 0.330 0.144 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 496 Number of extensions: 25 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 427 Length of database: 433 Length adjustment: 32 Effective length of query: 395 Effective length of database: 401 Effective search space: 158395 Effective search space used: 158395 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory