Align Amino-acid ABC transporter, ATP-binding protein (characterized, see rationale)
to candidate WP_029133010.1 A3GO_RS0108340 ABC transporter ATP-binding protein
Query= uniprot:Q88GX0 (260 letters) >NCBI__GCF_000428045.1:WP_029133010.1 Length = 236 Score = 145 bits (367), Expect = 6e-40 Identities = 90/225 (40%), Positives = 133/225 (59%), Gaps = 11/225 (4%) Query: 20 LIRIEGLNKHY--GAFHV--LRDIDLQVREGERIVLCGPSGSGKSTLIRCINRLEVAQQG 75 L+ ++G++K Y G V L++IDL V+EGE L GPSGSGK+TL+ I L+ G Sbjct: 3 LLTLQGVDKIYRQGELEVRALQEIDLTVQEGEFAALVGPSGSGKTTLLNIIGGLDAPSHG 62 Query: 76 SIQVDGIDLAATTREAAQVRS----DIGMVFQHFNLFPHMSVLDNCLLAPTSVRGLSRKD 131 SIQ++G + TT + A++ +G VFQ +NL P +S L+N L ++G ++ Sbjct: 63 SIQLNGTSI--TTLKEAELSDFRLFQLGFVFQAYNLVPVLSALENVELVMV-LQGRDVRE 119 Query: 132 AEERARMYLSKVGIESQAHKYPSQLSGGQQQRVAIARALCMKPRIMLFDEPTSALDPEMV 191 ERA YL VG+E + P+ LSGGQQQRVA+ARAL PR++L DEPT+ LD E Sbjct: 120 RRERAEHYLELVGLEKVMQRRPAALSGGQQQRVAVARALAAGPRLVLADEPTANLDSENA 179 Query: 192 AEVLDVLVQLAGTGMTMLCVTHEMGFARQVAERVLFLEGGQIIED 236 +LD++ +L+ T + + AER++ L G+I+ D Sbjct: 180 TALLDIMHRLSHEEKTTFIFSTHDRRVMERAERIITLRDGKIVSD 224 Lambda K H 0.322 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 145 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 236 Length adjustment: 24 Effective length of query: 236 Effective length of database: 212 Effective search space: 50032 Effective search space used: 50032 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory