Align 6-phospho-5-dehydro-2-deoxy-D-gluconate aldolase; DKGP aldolase; EC 4.1.2.29 (characterized)
to candidate WP_029133353.1 A3GO_RS0110470 fructose-bisphosphate aldolase class II
Query= SwissProt::P42420 (290 letters) >NCBI__GCF_000428045.1:WP_029133353.1 Length = 354 Score = 152 bits (383), Expect = 1e-41 Identities = 106/333 (31%), Positives = 170/333 (51%), Gaps = 49/333 (14%) Query: 1 MAFVSMKELLEDAKREQYAIGQFNINGLQWTKAILQAAQKEQSPVIAAASDRLVDYLGGF 60 M +SM++LL+ A Q+ + FN+N ++ AI+QAA + SPVI S Y G Sbjct: 1 MPLISMRQLLDYAADHQFGMPAFNVNNMEQVHAIMQAAHETDSPVIMQGSAGARAYAGET 60 Query: 61 KTIAAMVGALIEDMAITVPVVLHLDHGSSAERCRQAIDAGFSSVMIDGS-------HQPI 113 ++ AL + +P+V+H DHG+S C ++I +GFSSVM+DGS Sbjct: 61 FLRHLILAAL--EAYPHIPIVMHQDHGTSPAVCLRSIQSGFSSVMMDGSLMTDGKTPSSY 118 Query: 114 DENIAMTKEVTDYAAKHGVSVEAEVGTVGGMEDGL------VGGVRYAD----ITECER- 162 + N+ +T+ V + A GVSVE E+G +G +E G +G V D +T+ E+ Sbjct: 119 EYNVDVTRRVVEMAHAGGVSVEGELGCLGSLETGEAGEEDGIGAVGKLDMDQLLTDPEQA 178 Query: 163 --IVKETNIDALAAALGSVHGKYQ------GEPNLGFKEMEAISRMTDIPLVLHGASGIP 214 VK+T +DALA A+G+ HG Y+ GE + E R+ + LV+HG+S +P Sbjct: 179 ADFVKQTQVDALAIAIGTSHGAYKFTKKPTGEVLRIDRIKEIHQRIPNTHLVMHGSSSVP 238 Query: 215 QD---------------------QIKKAITLGHAKININTECMVAWTDETRRMFQENSDL 253 Q+ +I + I G K+NI+T+ +A T RR EN+ Sbjct: 239 QEWLAIINNFGGDMGQTYGVPVEEIVEGIKHGVRKVNIDTDLRMASTGSIRRHLHENTSN 298 Query: 254 YEPRGYLTPGIEAVEETVRSKMREFGSAGKAAK 286 ++PR +L + ++E +++ FG +G A+K Sbjct: 299 FDPRKFLKEATKGMKEICKARYEAFGCSGHASK 331 Lambda K H 0.316 0.132 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 292 Number of extensions: 15 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 290 Length of database: 354 Length adjustment: 28 Effective length of query: 262 Effective length of database: 326 Effective search space: 85412 Effective search space used: 85412 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory