Align methylmalonate-semialdehyde dehydrogenase (CoA-acylating) (EC 1.2.1.27) (characterized)
to candidate WP_029133426.1 A3GO_RS0110905 aldehyde dehydrogenase
Query= BRENDA::Q97YT9 (492 letters) >NCBI__GCF_000428045.1:WP_029133426.1 Length = 470 Score = 218 bits (556), Expect = 3e-61 Identities = 140/459 (30%), Positives = 229/459 (49%), Gaps = 11/459 (2%) Query: 16 KLYINGEFIDSKTDTIGKAYNPAKDEIIAEVPFSAKDEVEEAIQSAQEAFEKWREVPITT 75 KL I G ++ + NPA + ++A P ++ +++ A+ +A EAF +W+ T Sbjct: 6 KLLIGGAWVAGDNGSFD-VLNPATEAVVAACPTASVGQLDAAVAAAGEAFRQWQFSSNDT 64 Query: 76 RIQYLFALKNRLEEYSETIARIIVQNHGKTIQEARGDMRRTIENVEAAISAAYTLYKGEH 135 R Q L + +++E ++ +A I+V GK + A+ ++ + A + E Sbjct: 65 RKQLLHDIADKIEAHAAELAEIVVAEQGKPMFLAQAEVGGAVAWTRATAELDIPVEVIE- 123 Query: 136 LDQVSQEVDETVVREPLGVFGIITPFNFPTMVPFWFLPYAIVLGNTVVVKPSEITPVPMD 195 D + ++ + R+PLGV G ITP+N+P M+ W + A+ GNTVV+KPSE TP+ Sbjct: 124 -DSPGKRIE--MHRKPLGVVGSITPWNWPLMIAVWHIMPALRTGNTVVIKPSEFTPLNTL 180 Query: 196 FIIRIFDEIKLPRGVVNVVHGAKDVVDEFLTNKLVQGVTFVGSTRVGKYIYENAGKNGKK 255 ++ + +E+ P+GVVNVV G D+ + + + F GST GK I +A N K+ Sbjct: 181 RLVELINEVA-PKGVVNVVTGMSDIGRAMSVHTRINKIVFTGSTATGKDIMFHAANNLKR 239 Query: 256 AIVQAGAKNFVVVMPDADLNKAIPSIVSAFFGNAGQRCLAAANLVAVGNIYDEVKRKFIE 315 ++ G + +V+P D++ I F N GQ C A L +IY+ + K E Sbjct: 240 LTLELGGNDAGIVLPGTDVDAVAMPIFQGAFLNMGQTCAALKRLYVHDSIYEAMCGKLTE 299 Query: 316 ASKQLKIGYGLDESVDMGPVVTKDAKKRIIGYIEKGIEEGAKLLLDGRDVKVPEYPNGYF 375 ++Q ++G G+DE V GPV K + + +E GA++L G + +GYF Sbjct: 300 IAQQQQLGSGMDEGVTFGPVQNKKQLQIVSDLVEDARNNGARILCGGERLA----GSGYF 355 Query: 376 LGPTVFDEVTPEMVIAKEEIFGPVASIIHVKNLDEAINIINRSNYGNASSIFTTSGYYAR 435 PT+ E + M I EE FGPV +I ++D+A+ N + G S++ A Sbjct: 356 YPPTIVAEASDGMRIVDEEQFGPVLPVIRYSDVDDAVRRANDCDAGLGGSVWGADVESAT 415 Query: 436 KFRREVNTGNIGINIGVAAPMAFFPFGGRKESFFGILHG 474 + + G IN G A + PFGG K S FG+ G Sbjct: 416 QVATRLECGTAWIN-GHAEVLPHAPFGGCKMSGFGVEFG 453 Lambda K H 0.319 0.139 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 454 Number of extensions: 18 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 492 Length of database: 470 Length adjustment: 34 Effective length of query: 458 Effective length of database: 436 Effective search space: 199688 Effective search space used: 199688 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory