Align D-lactate transporter, permease component 2 (characterized)
to candidate WP_029133925.1 A3GO_RS0114010 branched-chain amino acid ABC transporter permease
Query= reanno::Phaeo:GFF1250 (340 letters) >NCBI__GCF_000428045.1:WP_029133925.1 Length = 338 Score = 489 bits (1258), Expect = e-143 Identities = 242/342 (70%), Positives = 292/342 (85%), Gaps = 6/342 (1%) Query: 1 MDAILLQILNGLDKGSAYALIALGLTLIFGTLGVVNFAHGALFMIGAFCAVTVQRVLSLS 60 MDAI LQILNGLDKG AYALIALGLTL+FGTLGVVNFAHGALFM+GAFCA+T++++L++S Sbjct: 1 MDAIFLQILNGLDKGGAYALIALGLTLVFGTLGVVNFAHGALFMLGAFCAITLEKILTIS 60 Query: 61 FETVDETQKDFLGNPLKVKTPYVESWFGPEVGGAIIDWAVPLAILFAIPIMIGVGYVMER 120 + DE+ F + PY+E WFG + G IIDW+VP++IL AIP+M+ +G VMER Sbjct: 61 MKVKDESITFF---DAYKEQPYLEIWFG-DFGTTIIDWSVPISILLAIPVMLLIGLVMER 116 Query: 121 GLIKHFYKRPHADQILVTFGLAIVLQEVVKYFYGANPIQTPAPDALNGVVNLGSIIGM-- 178 GLIKHFYKRPHA+QILVTFGLAIVLQE+VK F+GANPI +PAP+ +G +G ++G+ Sbjct: 117 GLIKHFYKRPHAEQILVTFGLAIVLQEIVKSFFGANPIPSPAPEIFSGSAPIGVLLGLGE 176 Query: 179 DIVYPVWRVVYFFFAVVIIGGIFSFLQFTTFGMVVRAGMADRETVGLLGINIDRRFTIMF 238 +VYP WR++Y F+ +II +F+FLQFTTFGMVVRAGM DRETVGLLGIN++ RFTI+F Sbjct: 177 SVVYPWWRLIYLLFSGIIIFAVFAFLQFTTFGMVVRAGMHDRETVGLLGINVEHRFTIVF 236 Query: 239 GIAAAVAGLAGVMYTPINSPNYHMGMDFLVLSFVVVVVGGMGSLPGAVLAGFLLGVLESF 298 GIAA VAGLAGVMY PI P+YHMGMDFLVLSFVVVVVGGMGSL GAV AGFLLG+L+SF Sbjct: 237 GIAAVVAGLAGVMYAPILPPDYHMGMDFLVLSFVVVVVGGMGSLGGAVAAGFLLGILQSF 296 Query: 299 ASMNEIKSLIPGIDQIIIYVVAIIILLTRPRGLMGRKGVMED 340 ASMNE+K++IPGIDQIIIY+VA++I+L RPRGLMGRKGVMED Sbjct: 297 ASMNEVKAIIPGIDQIIIYLVAVVIILVRPRGLMGRKGVMED 338 Lambda K H 0.329 0.147 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 456 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 340 Length of database: 338 Length adjustment: 28 Effective length of query: 312 Effective length of database: 310 Effective search space: 96720 Effective search space used: 96720 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory