Align Leucine/isoleucine/valine ABC transporter,permease component (characterized, see rationale)
to candidate WP_029133949.1 A3GO_RS0114170 branched-chain amino acid ABC transporter permease
Query= uniprot:G8ALI9 (505 letters) >NCBI__GCF_000428045.1:WP_029133949.1 Length = 410 Score = 327 bits (838), Expect = 5e-94 Identities = 185/382 (48%), Positives = 248/382 (64%), Gaps = 36/382 (9%) Query: 93 FFIAMPTEALRVILIAGGAVIAIRAVLAIRTGR-SKLSQAERDKRMDHIAAQV-QHASRW 150 FF+A+ + L ++ IR V +T R + S ++ D QV R+ Sbjct: 44 FFVAIGSFVLSIL---------IRVVNTQKTKRLERRSASDSDTTTSEPLIQVILQNPRY 94 Query: 151 LGPIA---VVVALAFPFTPLADRQLLDIGILLLTYIMLGWGLNIVVGLAGLLDLGYVAFY 207 L P+A V AL FP+ L D +I L Y++LG GLNIVVG+AGLLDLG+VAFY Sbjct: 95 LYPLAGAVTVFALVFPY--LFDTYQTNIMTTALMYVVLGLGLNIVVGMAGLLDLGFVAFY 152 Query: 208 AVGAYSYALLAHYFGFSFWVCLPLAGFLAAMSGVLLGFPVLRLRGDYFAIVTLGFGEIIR 267 AVGAYSYALL +FG FW+ LP+ AA G++LGFPVLRLRGDY AIVTLGFGEIIR Sbjct: 153 AVGAYSYALLNAHFGIGFWMALPIGALFAASFGIILGFPVLRLRGDYLAIVTLGFGEIIR 212 Query: 268 IILINWYQFTGGPNGISGIPRPSFFGIADFTRTPAEGTAAFHEMFGLEFSPLHRIIFLYY 327 +IL NW +F+ GP+GIS IPRP MFG+E S I+++YY Sbjct: 213 LILENWNEFSQGPSGISNIPRPG--------------------MFGIELSLEAAILYIYY 252 Query: 328 LILVLALVVNLFTMRVRKLPLGRAWEALREDDIACASLGINRTNMKLAAFAIAAMFGGFA 387 +++ L +V R++ LGRAW ALRED+IAC ++GI++T KL AFA+ A + G Sbjct: 253 IMVALVIVTIFVVNRLQDSRLGRAWIALREDEIACQAMGIDKTKTKLTAFALGATWAGMM 312 Query: 388 GSFFATRQGFISPESFTFIESAIILAIVVLGGMGSQIGVVVAAFLVIGLPEAFRELADYR 447 G FA + FI+P SFTF+ESAIIL+IVVLGGMGS +GV+V A ++I LPE R L+DYR Sbjct: 313 GVIFAAKTTFINPASFTFLESAIILSIVVLGGMGSILGVIVGALVLILLPEYLRALSDYR 372 Query: 448 MLAFGMGMVLIMLWRPRGLLAH 469 MLAFG +V++M+++P+G++++ Sbjct: 373 MLAFGAILVVMMIFKPQGIISN 394 Lambda K H 0.329 0.144 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 521 Number of extensions: 21 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 505 Length of database: 410 Length adjustment: 33 Effective length of query: 472 Effective length of database: 377 Effective search space: 177944 Effective search space used: 177944 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory