Align High-affinity branched-chain amino acid transport system permease protein BraE, component of Branched chain amino acid uptake transporter. Transports alanine (characterized)
to candidate WP_029133949.1 A3GO_RS0114170 branched-chain amino acid ABC transporter permease
Query= TCDB::P21628 (417 letters) >NCBI__GCF_000428045.1:WP_029133949.1 Length = 410 Score = 328 bits (841), Expect = 2e-94 Identities = 165/311 (53%), Positives = 223/311 (71%), Gaps = 20/311 (6%) Query: 97 ALVVVAFVWPFFASRGAVDIATLILIYVMLGIGLNIVVGLAGLLDLGYVGFYAVGAYTYA 156 A+ V A V+P+ +I T L+YV+LG+GLNIVVG+AGLLDLG+V FYAVGAY+YA Sbjct: 101 AVTVFALVFPYLFDTYQTNIMTTALMYVVLGLGLNIVVGMAGLLDLGFVAFYAVGAYSYA 160 Query: 157 LLAEYAGFGFWTALPIAGMMAALFGFLLGFPVLRLRGDYLAIVTLGFGEIIRILLRNMTE 216 LL + G GFW ALPI + AA FG +LGFPVLRLRGDYLAIVTLGFGEIIR++L N E Sbjct: 161 LLNAHFGIGFWMALPIGALFAASFGIILGFPVLRLRGDYLAIVTLGFGEIIRLILENWNE 220 Query: 217 ITGGPNGIGSIPKPTLFGLTFERRAPEGMQTFHEFFGIAYNTNYKVILLYVVALLLVLLA 276 + GP+GI +IP+P +FG+ A ++ +Y + + LV++ Sbjct: 221 FSQGPSGISNIPRPGMFGIELSLEA-------------------AILYIYYIMVALVIVT 261 Query: 277 LFVINRLMRMPIGRAWEALREDEVACRALGLNPTIVKLSAFTIGASFAGFAGSFFAARQG 336 +FV+NRL +GRAW ALREDE+AC+A+G++ T KL+AF +GA++AG G FAA+ Sbjct: 262 IFVVNRLQDSRLGRAWIALREDEIACQAMGIDKTKTKLTAFALGATWAGMMGVIFAAKTT 321 Query: 337 LVTPESFTFIESAMILAIVVLGGMGSQLGVILAAVVMVLLQE-MRGFNEYRMLIFGLTMI 395 + P SFTF+ESA+IL+IVVLGGMGS LGVI+ A+V++LL E +R ++YRML FG ++ Sbjct: 322 FINPASFTFLESAIILSIVVLGGMGSILGVIVGALVLILLPEYLRALSDYRMLAFGAILV 381 Query: 396 VMMIWRPQGLL 406 VMMI++PQG++ Sbjct: 382 VMMIFKPQGII 392 Lambda K H 0.330 0.146 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 508 Number of extensions: 30 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 3 Number of HSP's successfully gapped: 1 Length of query: 417 Length of database: 410 Length adjustment: 31 Effective length of query: 386 Effective length of database: 379 Effective search space: 146294 Effective search space used: 146294 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory