Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate WP_029133951.1 A3GO_RS0114180 ABC transporter ATP-binding protein
Query= uniprot:Q1MCU3 (247 letters) >NCBI__GCF_000428045.1:WP_029133951.1 Length = 235 Score = 246 bits (628), Expect = 3e-70 Identities = 126/235 (53%), Positives = 170/235 (72%), Gaps = 1/235 (0%) Query: 11 LLQVNGVETYYGNIRALAGVDVHVNKGEIVSLIGANGAGKSTLMMTICGSPQARTGSVVF 70 +L++ V+ YYGNI+AL G+++ V +GEI++LIGANGAGKST +M+I G R G V++ Sbjct: 1 MLELRNVDAYYGNIQALKGINLEVREGEIITLIGANGAGKSTTLMSISGIVPPRNGQVLY 60 Query: 71 EGRDITRMPTHEIARLRIAQSPEGRRIFPRMTVLENLQMGAGLDNLKH-FAEDVEKIFTL 129 +G I + +I + I Q PEGR IFP++TV ENL MGA L + K +D++ +F+L Sbjct: 61 KGEPIHNVAPDKIVAMGICQVPEGRHIFPQLTVQENLDMGAFLRSDKRGIQKDLDYVFSL 120 Query: 130 FPRLKERHAQRGGTLSGGEQQMLSIGRALMARPKLLLLDEPSLGLAPLIVKGIFEAIRKL 189 FP L ER Q GG LSGGEQQML++ RALMARP LLLLDEPS+GLAPLI++ IFE I+K+ Sbjct: 121 FPILDERRHQAGGNLSGGEQQMLAMSRALMARPDLLLLDEPSMGLAPLIIRQIFEIIKKI 180 Query: 190 NEAEGLTVFLVEQNAFAALRLSHRAYVMVNGKVTMSGSGKELLANPEVRAAYLEG 244 N+ T+FLVEQNA AL ++ R YV+ NG +T+S +LLAN +V+ AYL G Sbjct: 181 NDENNTTIFLVEQNANQALHIADRGYVIENGSITISDDADKLLANQDVQKAYLGG 235 Lambda K H 0.320 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 197 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 235 Length adjustment: 23 Effective length of query: 224 Effective length of database: 212 Effective search space: 47488 Effective search space used: 47488 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory