Align Transmembrane component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate WP_029133958.1 A3GO_RS0114215 branched-chain amino acid ABC transporter permease
Query= uniprot:Q1MCU0 (300 letters) >NCBI__GCF_000428045.1:WP_029133958.1 Length = 304 Score = 403 bits (1035), Expect = e-117 Identities = 204/306 (66%), Positives = 254/306 (83%), Gaps = 8/306 (2%) Query: 1 MEYFVQQLLNGLTLGSIYGLVAIGYTMVYGIIGMINFAHGDIFMLGGFAALIVFLVLTSI 60 MEYF+QQL+NG+TLGSIYGL+AIGYTMVYGIIGMINFAHGD+FM+G F +LI FLVL I Sbjct: 1 MEYFIQQLINGVTLGSIYGLIAIGYTMVYGIIGMINFAHGDVFMIGAFLSLIAFLVLGII 60 Query: 61 -FAGLPVAVLLLVMLVVAMLMTSLWNWTIERVAYRPLRGSFRLAPLITAIGMSITLSNFI 119 +P+A LLV+L+V+ML+ S++ WT+ER+AYRPLRGSFRLAPLI+AIGMSI L N++ Sbjct: 61 GITWIPLA--LLVVLLVSMLIASVYGWTVERLAYRPLRGSFRLAPLISAIGMSIFLQNYV 118 Query: 120 QVTQGPRNKPIPPMVSSVYQFGN-----ISVSLKQIIIIVITAVLLTIFWYIVNRTALGR 174 Q+ QG R +P+PP++S + F I+VS QI+I+++T L+T F ++ RT+LGR Sbjct: 119 QLLQGARVRPMPPVISGGFTFLEGSDFPITVSYLQIVIVLLTIALMTGFALLIARTSLGR 178 Query: 175 AQRATEQDRKMAALLGVNVDQTISITFVMGAALAAVAGTMYLMYYGVASFNDGFTPGVKA 234 AQR EQDR M+ALLG+NVD+TIS+TFVMGAALAAVAG M+++YYGV F GF G+KA Sbjct: 179 AQRGCEQDRTMSALLGINVDRTISLTFVMGAALAAVAGMMFVLYYGVIDFYIGFLAGIKA 238 Query: 235 FTAAVLGGIGSLPGAVFGGLLIGLIESLWSAYFTIAYKDVATFAILAFVLIFKPTGILGR 294 FTAAVLGGIGSLPGA+ GGLLIGLIE+ WSAYF+I YKDVA FAIL VLIF+PTG+LG+ Sbjct: 239 FTAAVLGGIGSLPGAMLGGLLIGLIETYWSAYFSIEYKDVAAFAILVLVLIFRPTGLLGK 298 Query: 295 PEVEKV 300 PE+EKV Sbjct: 299 PEIEKV 304 Lambda K H 0.329 0.143 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 426 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 300 Length of database: 304 Length adjustment: 27 Effective length of query: 273 Effective length of database: 277 Effective search space: 75621 Effective search space used: 75621 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory