Align methylmalonyl-CoA mutase (subunit 2/2) (EC 5.4.99.2) (characterized)
to candidate WP_029133988.1 A3GO_RS0114395 methylmalonyl-CoA mutase
Query= BRENDA::O74009 (563 letters) >NCBI__GCF_000428045.1:WP_029133988.1 Length = 1085 Score = 308 bits (789), Expect = 7e-88 Identities = 211/601 (35%), Positives = 326/601 (54%), Gaps = 56/601 (9%) Query: 9 LKKIKEEEKRWEETTVKKFLEKAPERKEKFMTDD--------------------GFEIKR 48 L ++ E + KK LE P+ K+ + D+ G +I + Sbjct: 487 LDRLIAERDEALDQRAKKLLEIWPQVKQSYAGDEYVVKIRDKEIRTQITRTTLSGTKIPK 546 Query: 49 IYTPA--DLGEDWNYMEKLGFPGEYPFTRGVYATMYRGRIWTMRQYAGYATAEESNKRYK 106 + P D GE ++ PG +P+T GV+A G T R +AG A +N+R+K Sbjct: 547 VVLPKYEDHGELLKWLLLENVPGTFPYTAGVFAFKREGEDPT-RMFAGEGDAFRTNRRFK 605 Query: 107 YLLSQGQTG-LSVAFDLPTQLGYDSDH-PLAEGEVGKVGVAIDSLWDMRILFDGIPLDKV 164 L LS AFD T G D D P G++G GV+I +L DM++L+DG L Sbjct: 606 KLSEHSDAKRLSTAFDSVTLYGCDPDERPDIYGKIGNSGVSIATLDDMKVLYDGFDLCNP 665 Query: 165 STS--MTINSTAANLLAMYILVAEEQGVSQ----------------------EKLRGTVQ 200 STS MT+N A +LAM++ A +Q +++ +RGTVQ Sbjct: 666 STSVSMTVNGPAPMILAMFLNSAIDQQINKFETDNGRQPTDEEIEKIRAWTLSNVRGTVQ 725 Query: 201 NDILKEYIARGTYIFPPQPSMRLTTDIIMYCAEN-VPKWNPISISGYHIREAGANAVQEV 259 DILKE + T IF + +++L DI Y + V + +SISGYHI EAGAN + ++ Sbjct: 726 ADILKEDQGQNTCIFSTEFALKLMGDIQEYFVHHQVRNFYSVSISGYHIAEAGANPISQL 785 Query: 260 AFTLADGIEYVKAVIERGMDVDKFAPRLSFFFAAHNNFLEEIAKFRAARRLWAYIMKEWF 319 AFTLA+G YV+ + RGMD+D+FAP LSFFF+ + E R ARR+WA M+ + Sbjct: 786 AFTLANGFTYVETYLARGMDIDEFAPNLSFFFS-NGMDPEYTVMGRVARRIWATAMRFKY 844 Query: 320 NAKNPRSMMLRFHTQTAGSTLTAQQPENNIVRVAIQALAAVLGGTQSLHTNSYDEALSLP 379 A N RS L++H QT+G +L AQ+ + N +R +QAL A+ SLHTN+YDEA++ P Sbjct: 845 GA-NERSQKLKYHIQTSGRSLHAQEMDFNDIRTTLQALIAIYDNCNSLHTNAYDEAITTP 903 Query: 380 TEKSVRIALRTQQIIAYESGVVDTVDPLGGAYYIEWLTDHIYEEALKYIEKIQKMGGMMR 439 TE+SVR AL Q II E G+ +P GA+ I+ LT+ + E L E+I + GG++ Sbjct: 904 TEESVRRALAIQLIINNEWGLTKNENPNQGAFIIDELTELVEEAVLSEFERISERGGVLG 963 Query: 440 AIERGYVQKEIAEAAYKYQKEIEEGKRIIVGVNAFVTDEPIEVEILKVDPSIREKQIERL 499 A+E GY + +I + + Y+ +G I+GVN F+ + E +++ S E+++ ++ Sbjct: 964 AMETGYQRGKIQDESLHYEHMKHDGSLPIIGVNTFLNPKGNEEVTIELARSTEEEKLSQI 1023 Query: 500 KKLR--SERDNKKVQEALDKLRNAAEKEDENLMPYIIEAHRHLATLQEVTDVLREIWGEY 557 K+LR ++R AL+++R+AA +EN+ ++ A R +L ++++ L E+ G+Y Sbjct: 1024 KRLREFNQRHATAADTALERIRSAA-INNENIFVELMNAVRS-CSLGQISNALYEVGGQY 1081 Query: 558 R 558 R Sbjct: 1082 R 1082 Lambda K H 0.318 0.134 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 1234 Number of extensions: 68 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 563 Length of database: 1085 Length adjustment: 41 Effective length of query: 522 Effective length of database: 1044 Effective search space: 544968 Effective search space used: 544968 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 55 (25.8 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory