Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate WP_029133994.1 A3GO_RS0114425 ABC transporter ATP-binding protein
Query= uniprot:Q1MCU2 (292 letters) >NCBI__GCF_000428045.1:WP_029133994.1 Length = 261 Score = 197 bits (502), Expect = 2e-55 Identities = 107/261 (40%), Positives = 164/261 (62%), Gaps = 9/261 (3%) Query: 12 DTLLKVEHLSMKFGGLMAINDFSFEAKRGDITALIGPNGAGKTTVFNCITGFYKPTMGMI 71 + +L ++++S+ FG + +N+ SF+ ++ +I ++IGPNGAGK+++ N I G Y P G I Sbjct: 8 EVILDLKNISLSFGAMRVLNNISFDVRKSEIRSIIGPNGAGKSSMLNVINGVYHPQEGEI 67 Query: 72 TFNQKSGKQYLLERLPDFRITKEARVARTFQNIRLFSGLTVLENLLVAQHNKLMKASGYT 131 +F + KQ + F I ARTFQNI LF G++ L+N++ ++ K MK+S ++ Sbjct: 68 SFRGEVRKQMKVHEAAGFGI------ARTFQNIALFKGMSTLDNIMTGRNLK-MKSSMFS 120 Query: 132 ILGLIGVGPYKREAAEAIELARFWLEKADLIDRADDPAGDLPYGAQRRLEIARAMCTGPE 191 I G ++E E ++ ++ P G LPYG Q+R+E+ RA+ PE Sbjct: 121 --QAIYWGKAQKEEIEHRRKVEEIIDFLEIQAIRKTPVGRLPYGMQKRVELGRALAAEPE 178 Query: 192 LLCLDEPAAGLNPRESATLNALLKSIRAETGTSILLIEHDMSVVMEISDHVVVLEYGQKI 251 +L LDEP AG+N E ++ + I E GT+I+LIEHDM VVM+ISD VVVL+YG+++ Sbjct: 179 ILLLDEPMAGMNVEEKEDMSRFVLDINDEFGTTIVLIEHDMGVVMDISDRVVVLDYGRQL 238 Query: 252 SDGTPDHVKNDPRVIAAYLGV 272 +DGTPD V+N+ VI AYLGV Sbjct: 239 ADGTPDVVRNNQDVIDAYLGV 259 Lambda K H 0.318 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 167 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 261 Length adjustment: 25 Effective length of query: 267 Effective length of database: 236 Effective search space: 63012 Effective search space used: 63012 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory