Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate WP_029133998.1 A3GO_RS0114445 ABC transporter ATP-binding protein
Query= uniprot:Q1MCU3 (247 letters) >NCBI__GCF_000428045.1:WP_029133998.1 Length = 271 Score = 194 bits (493), Expect = 2e-54 Identities = 107/239 (44%), Positives = 150/239 (62%), Gaps = 8/239 (3%) Query: 12 LQVNGVETYYGN-IRALAGVDVHVNKGEIVSLIGANGAGKSTLMMTICGSPQARTGSV-- 68 L+VN +E Y + I L GV + V KG IV+L+GANGAGKST + I A G V Sbjct: 9 LEVNNIEVIYDHVILVLKGVSLEVPKGGIVALLGANGAGKSTTLKAISNLLGAERGDVTK 68 Query: 69 ---VFEGRDITRMPTHEIARLRIAQSPEGRRIFPRMTVLENLQMGAGL--DNLKHFAEDV 123 +++G + + ++ R + Q EGR F +T+ ENL GA D K A+ + Sbjct: 69 GNILYKGEAVESLNPSDLVRRGVVQVMEGRHCFEHLTIEENLLTGAYTRRDGRKAIAQSL 128 Query: 124 EKIFTLFPRLKERHAQRGGTLSGGEQQMLSIGRALMARPKLLLLDEPSLGLAPLIVKGIF 183 E I+ FPRL+ER + + G SGGEQQM +IGRA++A+P+++LLDEPS+GLAP +V+ IF Sbjct: 129 EMIYDYFPRLRERRSSQAGYTSGGEQQMCAIGRAMLAQPEMILLDEPSMGLAPQLVEEIF 188 Query: 184 EAIRKLNEAEGLTVFLVEQNAFAALRLSHRAYVMVNGKVTMSGSGKELLANPEVRAAYL 242 E ++KLN+ EG++ L EQN ALR S Y+M NG+V M G+ KEL N +V+ YL Sbjct: 189 EIVKKLNQNEGVSFLLAEQNTNVALRYSDYGYIMENGRVVMEGNAKELSENEDVKEFYL 247 Lambda K H 0.320 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 189 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 271 Length adjustment: 24 Effective length of query: 223 Effective length of database: 247 Effective search space: 55081 Effective search space used: 55081 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory