Align Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial; MCCase subunit alpha; 3-methylcrotonyl-CoA carboxylase 1; 3-methylcrotonyl-CoA:carbon dioxide ligase subunit alpha; EC 6.4.1.4 (characterized)
to candidate WP_029134752.1 A3GO_RS0119025 acetyl-CoA carboxylase biotin carboxylase subunit
Query= SwissProt::Q2QMG2 (737 letters) >NCBI__GCF_000428045.1:WP_029134752.1 Length = 446 Score = 433 bits (1114), Expect = e-126 Identities = 219/445 (49%), Positives = 296/445 (66%), Gaps = 5/445 (1%) Query: 39 VEKVLVANRGEIACRVMRTARRLGIPTVAVYSDADRGALHVRAADEAVRLGPPPARESYL 98 +EK+++ANRGEIA R++R R LGI TVAV+S+ADR HVR ADE V +GP P+ SYL Sbjct: 2 IEKIVIANRGEIALRILRACRELGIKTVAVHSEADRELKHVRLADETVCIGPAPSAGSYL 61 Query: 99 NASAIVDAALRTGAKAIHPGYGFLSESADFAQLCKAEGLTFIGPPPSAIRDMGDKSASKR 158 +I+ AA T A AIHPGYGFLSE+ADFA+ + G FIGP P IR MGDK + Sbjct: 62 QVHSIISAAEVTDAVAIHPGYGFLSENADFAERVEESGFIFIGPKPETIRMMGDKITAIE 121 Query: 159 IMGAAGVPLVPGYHGAEQDIELLKLE-ANKIGYPVLIKPTHGGGGKGMRIVQRPEDFVDS 217 M AAGVP VPG G + E L+ A IGYPV+IK GGGG+GMR+V +++ Sbjct: 122 AMKAAGVPCVPGSDGPLDNDERKTLKMATDIGYPVIIKAAGGGGGRGMRVVHTEATLLNA 181 Query: 218 VLSAQREAAASFGINTLLVEKYITQPRHIEVQIFGDQHGNVIHLYERDCSLQRRHQKIIE 277 + + EA A+FG +T+ +EKY+ PRH+E Q+ D HGN IHL ERDCS+QRRHQK++E Sbjct: 182 ISLTKAEAGAAFGNDTVYMEKYLENPRHVEFQVLADTHGNAIHLGERDCSMQRRHQKVVE 241 Query: 278 EAPAPNVTAQFRSHIGEAAVSAAKAVGYYSAGTVEFIVDTLSGEFYFMEMNTRLQVEHPV 337 EAPAP ++ + R+ +GE A + +GY AGT EF+ + +GEFYF+EMNTR+QVEHPV Sbjct: 242 EAPAPGISEELRNRLGERCAEACRRIGYRGAGTFEFLYE--NGEFYFIEMNTRIQVEHPV 299 Query: 338 TEMIVGQDLVEWQIRIANGECLPLSQEQVPLNGHAFEARIYAENVPRGFLPATGTLHHYR 397 TEMI G D+V+ Q+RIA GE L Q + + GHA E RI AE+ P F+P+ G + H Sbjct: 300 TEMITGVDIVKEQLRIAAGEALAYRQSDIQIRGHAVECRINAED-PDSFMPSPGDITHLH 358 Query: 398 PVPSTATVRVETGVEEGDTVSMHYDPMIAKLVVWGESRNAALVKLKNSLSNFQIAGLPTN 457 +P +RV+T + +G V HYD MI KL+ GE+R +A+ ++K +LS + G+ TN Sbjct: 359 -IPGGPGIRVDTHIYDGYRVPPHYDSMIGKLIAHGENRASAIARMKTALSEMVVDGIKTN 417 Query: 458 VGFLQELAGHSAFEKGLVDTHFIER 482 + Q + AF KG + H++E+ Sbjct: 418 IPLQQRIMQDEAFAKGGANIHYLEK 442 Lambda K H 0.317 0.133 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 745 Number of extensions: 35 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 737 Length of database: 446 Length adjustment: 36 Effective length of query: 701 Effective length of database: 410 Effective search space: 287410 Effective search space used: 287410 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory