Align D-lactate oxidase and glycolate oxidase, iron-sulfur subunit (EC 1.1.3.15) (characterized)
to candidate WP_029134886.1 A3GO_RS0119900 glycolate oxidase iron-sulfur subunit
Query= reanno::psRCH2:GFF3770 (405 letters) >NCBI__GCF_000428045.1:WP_029134886.1 Length = 405 Score = 499 bits (1284), Expect = e-146 Identities = 250/405 (61%), Positives = 296/405 (73%), Gaps = 2/405 (0%) Query: 1 MQTNLSEAAKKLPRAEEAESILRSCVHCGFCNATCPTYQLLGDELDGPRGRIYLMKQMFE 60 MQTNL P +EA++ILRSCVHCGFC ATCPTYQLLGDELD PRGRIYL+KQ+ E Sbjct: 1 MQTNLPRDFLNTPHGQEADAILRSCVHCGFCTATCPTYQLLGDELDSPRGRIYLIKQVLE 60 Query: 61 GGEVTESTQLHLDRCLTCRNCETTCPSGVKYHNLLDIGRDFIEQQVQRPLGERVVRGGLR 120 G VTE TQ HLDRCLTCR CETTCPSGV+Y LLDIGR +EQQV RPL V+R GLR Sbjct: 61 GAPVTERTQRHLDRCLTCRACETTCPSGVRYARLLDIGRGVVEQQVGRPLFAGVMRWGLR 120 Query: 121 TVIPRPGLFKALLGAGNALKPLMPASLKDHLPREIRPAKPRPQVMHSRRVLILEGCVQPS 180 V+P P F LG G +PL+ A LK LP P+ RP H+R +L+LEGC Q Sbjct: 121 HVLPYPKRFALALGLGQLFRPLLSARLKQKLPARGAPS-VRPITKHARTLLVLEGCAQSV 179 Query: 181 LSPSTNAAAARVLDRLGISVSPAREAGCCGAVDYHLNAQDAGLDRARRNIDAWWPAIEAG 240 +P+TNAAAARVLDRLGIS+ GCCGAV HL A+ RRNIDAWWP IE+G Sbjct: 180 ATPNTNAAAARVLDRLGISLISPTGQGCCGAVSQHLAAEAEAAGFMRRNIDAWWPHIESG 239 Query: 241 AEAIVQTASGCGAFVKEYGHLLKDDPAYAAKAARVSELAKDLVEVLRSAELEKLNVR-AD 299 E I+ TASGCG VKEYG LL+ DPAYAAKA RVSELA+DL EVL + LE L++ A Sbjct: 240 VEGILITASGCGTQVKEYGELLQHDPAYAAKARRVSELARDLCEVLETEPLETLSIAGAG 299 Query: 300 KRMAFHCPCTLQHAQKLGGAVEDVLTRLGYQLTAVPDAHLCCGSAGSYSITQPEISHQLR 359 +++A+H PC+LQH Q+L G VE VL RLG++LT V D+HLCCGSAG+YSI QP +S +L Sbjct: 300 RQIAYHSPCSLQHGQQLAGRVEAVLLRLGFELTPVVDSHLCCGSAGTYSILQPALSQRLL 359 Query: 360 DNKLNALESGKPEVIVTANIGCQTHLDGAGRTPVKHWIEVVEESM 404 DNKL ALE+ PE IV+AN+GCQ HL G + PVKHWIE+++E+M Sbjct: 360 DNKLAALEAAGPECIVSANVGCQLHLQGGAQRPVKHWIELLDEAM 404 Lambda K H 0.319 0.135 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 582 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 405 Length of database: 405 Length adjustment: 31 Effective length of query: 374 Effective length of database: 374 Effective search space: 139876 Effective search space used: 139876 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory