Align Putrescine transport system permease protein PotI (characterized)
to candidate WP_032983860.1 RL_RS33770 ABC transporter permease
Query= SwissProt::P0AFL1 (281 letters) >NCBI__GCF_000009265.1:WP_032983860.1 Length = 260 Score = 121 bits (304), Expect = 1e-32 Identities = 86/251 (34%), Positives = 133/251 (52%), Gaps = 11/251 (4%) Query: 10 PWRIVILLLGFTFLYAPMLMLVIYSFNSSKLVTVWA-GWSTRWYGELLRDDAMMSAVGLS 68 P+ V L+ + FL AP+L++V SFN+ +T G S RWY ++ M A+ S Sbjct: 4 PFLTVYCLVIYAFLLAPILVVVGASFNAGAFLTFPPQGLSFRWYLVFFNNEVFMRAIRTS 63 Query: 69 LTIAACAATAAAILGTIAAVVLVRF-GRFRGSNGFAFMITAPLVMPDVITGLSLLLLFVA 127 L IA + I+GT+AA+ V++ G+F+ + A + APL++P+V+T +SLL F Sbjct: 64 LWIATLTTIISGIIGTMAAMFYVQYAGKFKDTVRIAML--APLLLPEVLTAISLL--FFV 119 Query: 128 LAHAIGWPADRGMLTIWLAHVTFCTAYVAVVISSRLRELDRSIEEAAMDLGATPLKVFFV 187 + IG G+L L HV +V + +S+ + D S AA LGA F Sbjct: 120 YSIGIGTQTIVGLL---LGHVLITLPFVFINVSASMESYDPSWSLAAQSLGAGRFTRFRR 176 Query: 188 ITLPMIMPAIISGWLLAFTLSLDDLVIASFVSGPGATTLPMLVFSSVRMGVNPEINALAT 247 I LP+I P +I G L AF +S D I+ + G +TLP+ +F +R PE A++T Sbjct: 177 IMLPLIKPGVIGGCLFAFIVSFDVFTISFMLKNVGTSTLPIQLFDYLRTNFTPEAAAVST 236 Query: 248 --LILGAVGIV 256 +IL + +V Sbjct: 237 CSIILTLIVVV 247 Lambda K H 0.330 0.140 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 191 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 260 Length adjustment: 25 Effective length of query: 256 Effective length of database: 235 Effective search space: 60160 Effective search space used: 60160 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory