Align NAD(P)+-dependent L-rhamnose 1-dehydrogenase (EC 1.1.1.378; EC 1.1.1.173) (characterized)
to candidate WP_034194084.1 sugar dehydrogenase
Query= metacyc::MONOMER-16231 (254 letters) >NCBI__GCF_000016205.1:WP_034194084.1 Length = 253 Score = 162 bits (409), Expect = 8e-45 Identities = 104/247 (42%), Positives = 138/247 (55%), Gaps = 7/247 (2%) Query: 7 KTVLVTGASTGIGRAAAIGAAQHGADVAINYAHSDGPAQSCVAEIEALGQRAIAVKGDVA 66 KTVL+TGAS GIGRA+A+ AA G DV INY A+ + G RA V GDV+ Sbjct: 8 KTVLITGASRGIGRASAVLAAARGWDVGINYTRDAAAAELTARAVRDAGGRACVVAGDVS 67 Query: 67 DPQTAQDFVAKAVETFGKVDVMVSNAGI-CPFHAFLDMPVDVVERTFKVNLHGAYFMVQA 125 + FG++D +V+NAGI P DM VD + R F N+ GAY + Sbjct: 68 NEADVIAMFDAVATAFGRLDALVNNAGIVAPSMPLADMSVDRLRRMFDTNVLGAYLCARE 127 Query: 126 AAQQMV--RQGHGGSIVAVSSISALVG--GEYQTHYTPTKAGVHSLMQSTAIALGKHGIR 181 AA+++ R G GG+IV VSSI++ +G EY Y +K V +L A LG HG+R Sbjct: 128 AARRLSTDRGGRGGAIVNVSSIASRLGSPNEY-VDYAGSKGAVDALTIGLAKELGPHGVR 186 Query: 182 CNSVLPGTILTEINKDDLADQEKREYMEARTPLGRLGAPEDLAGPIVFLASDMAAYVTGA 241 N+V PG I TEI+ ++ + A+TPLGR G ++A IV+L SD A+Y TGA Sbjct: 187 VNAVRPGLIETEIHASG-GQPDRAARLGAQTPLGRAGEAHEIAEAIVWLISDAASYTTGA 245 Query: 242 ALLVDGG 248 L V GG Sbjct: 246 LLDVGGG 252 Lambda K H 0.318 0.133 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 118 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 253 Length adjustment: 24 Effective length of query: 230 Effective length of database: 229 Effective search space: 52670 Effective search space used: 52670 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory